C10orf68(CCDC7) (NM_145023) Human Tagged ORF Clone

CAT#: RC205417

CCDC7 (Myc-DDK-tagged)-Human coiled-coil domain containing 7 (CCDC7), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name C10orf68(CCDC7) (NM_145023) Human Tagged ORF Clone
Symbol CCDC7
Synonyms BioT2-A; BioT2-B; BioT2-C; C10orf68
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205417 representing NM_145023
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACCAGTAAAGCATCTGTTGACCACCAGTAACAAATCGGCAAATGTTCCAGCATTAACTACTAAAA
AAGGACTACATAATTTACCATTATCACCTGAGCTAAAGGAAAAACATAATGCAAAATTAATTCATGATAA
AATTGAACCAATGGTCCTAAGATCTCCACCAACAGGAGAATCCATTTTACGGTATGCTTTGCCCATTCCA
TCGAGTAAGACAAAGAACTTACTACCAGAAGATGAAATGATCGGAAAAATTATCAAACATCTGAAGATGG
TTGTTTCCACTTTGGAAGAAACCTATGGACATTGCGATCAGAATGGAGAAGAACCATTTGTAAAGCATGA
ACATGAAGAATTATCTTTATCTGTTGGGGATGATATGAATTCATTCTTGACATATTGTTCGCAATTTGCA
GCTCAGCTAGAAGAAGCACTTAAAGAAGAACAAAATATTTTGGAATCTCTTTTTAAGTGGTTTCAGTGGC
AGGTCAATCAGATGGAAGAAATAAGTAAAGATCAAACTCTTTTACAAGCAGAGCCTCCAAAACCTGACAA
AACAGTCATTTTAAATATTGCAGAAATAGTAAGGCTTGTACAAAGATTTGAAGAACTGAAGAATCGCCTT
AAACAGAGGTCTAAATCCTCCGTGAAAGTCATGTTGTCTAAAACTATGGATAAAGAAAATCGACCAGAAG
CAGTGAAAAGTTGTGAAGCTCTGGCACAGAAAATTGAAGAATTCTTAGAAGCCCACTCAACTGATGAATT
TAAAGATGTTTCTGCAACAGAACCACAAACTGCTCATTCAATGACTAATCGATTTAATGCCATGTTGAAA
GTATTTGAAAACCAGGCAAATATGTTGGAGAGAGCTGTAAATGATCAAGTTTTGTTAGATGCTGAATACA
AACAGATGCAGTGTGATTTTCAGTTGTTATCAGAAGAGAAGTTGGTGCTGGAAAATGAACTACAAAAGTT
GAAGGACAAAGAGAAAACTAAGCCTACAAATAATCGAACAAAGAAAGCTGTGAAAACAGTGAAGAAAAAA
GACAAAGGAAAATCTGAGGATTCAGAAAAGAAGATGTCTCCAGAAAAAGAGTTTAAAATAAAAGAAGATT
TGGATCAAGTACAGAAAGTAGCACGTCTGGAAATTGAGAACAAAGTCCTTCAGGAGCAATTGAAACAGGC
TTTACAGGAAGCTGAAAAAGCTAAGCATCAACTTAACTATTTCCTAAATCAAGAGAAGTTACTTAAAAGT
GAGGGGAAAACTGAGACAACAATGCAAGTGGGTAATAGTCAAACAAAAGTTAAAGGTGAAGATTCAAAAA
ATATACCATTGGAGAAAGAAACAAGAAAATCACTGGTTTCAGATTCAGGTGGACAAAGGACAAGTGATAA
AATCCAAGAATATCCACAGATCACTGCCCAAAGCGGAAGACTGATTGAAAAGAGATGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205417 representing NM_145023
Red=Cloning site Green=Tags(s)

MKPVKHLLTTSNKSANVPALTTKKGLHNLPLSPELKEKHNAKLIHDKIEPMVLRSPPTGESILRYALPIP
SSKTKNLLPEDEMIGKIIKHLKMVVSTLEETYGHCDQNGEEPFVKHEHEELSLSVGDDMNSFLTYCSQFA
AQLEEALKEEQNILESLFKWFQWQVNQMEEISKDQTLLQAEPPKPDKTVILNIAEIVRLVQRFEELKNRL
KQRSKSSVKVMLSKTMDKENRPEAVKSCEALAQKIEEFLEAHSTDEFKDVSATEPQTAHSMTNRFNAMLK
VFENQANMLERAVNDQVLLDAEYKQMQCDFQLLSEEKLVLENELQKLKDKEKTKPTNNRTKKAVKTVKKK
DKGKSEDSEKKMSPEKEFKIKEDLDQVQKVARLEIENKVLQEQLKQALQEAEKAKHQLNYFLNQEKLLKS
EGKTETTMQVGNSQTKVKGEDSKNIPLEKETRKSLVSDSGGQRTSDKIQEYPQITAQSGRLIEKRC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_145023
ORF Size 1458 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_145023.3, NM_145023.4, NM_145023.5, NP_659460
RefSeq Size 2173
RefSeq ORF 1461
Locus ID 79741
Cytogenetics 10p11.22
MW 55.6 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)