GLE1 (NM_001003722) Human Tagged ORF Clone

CAT#: RC205354

Reviews ()
Write a review

GLE1 (Myc-DDK-tagged)-Human GLE1 RNA export mediator homolog (yeast) (GLE1), transcript variant 1

  View "NM_001003722" in other vectors (6)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GLE1 (NM_001003722) Human Tagged ORF Clone
Symbol GLE1
Synonyms GLE1L; hGLE1; LCCS; LCCS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205354 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCTGAGGGTCGCTGCTGGGAGACCTTGAAGGCCCTACGCAGTTCCGACAAAGGTCGCCTTTGCT
ACTACCGCGACTGGCTGCTGCGGCGCGAGGATGTTTTAGAAGAATGTATGTCTCTTCCCAAGCTATCTTC
TTATTCTGGATGGGTGGTAGAGCACGTCCTACCCCATATGCAGGAGAACCAACCTCTGTCTGAGACTTCG
CCATCCTCTACGTCAGCTTCAGCCCTAGATCAACCCTCATTTGTTCCCAAATCTCCTGACGCAAGCTCTG
CCTTTTCCCCAGCCTCCCCTGCAACACCAAATGGAACCAAGGGCAAAGATGAGTCCCAGCACACAGAATC
TATGGTACTTCAGTCCTCACGGGGGATCAAAGTGGAAGACTGCGTCCGAATGTACGAACTGGTACACAGA
ATGAAAGGAACAGAGGGCCTGAGGCTATGGCAGGAGGAGCAGGAGAGGAAGGTGCAAGCCCTCTCGGAGA
TGGCATCTGAACAACTGAAGCGGTTTGATGAATGGAAGGAACTGAAGCAGCATAAAGAATTCCAGGACTT
GCGGGAAGTAATGGAGAAGAGCTCCAGAGAAGCCTTGGGACACCAAGAGAAGCTAAAAGCTGAGCACCGT
CACAGAGCAAAGATTCTCAACCTGAAGCTGCGGGAAGCAGAGCAGCAGCGCGTGAAGCAAGCAGAACAGG
AGCGGCTTCGGAAGGAAGAAGGCCAGATCCGCCTGCGGGCCCTCTATGCTCTGCAGGAGGAGATGCTGCA
GCTCAGCCAGCAGCTGGATGCCTCTGAGCAGCACAAAGCCCTGCTTAAGGTCGACCTGGCTGCCTTCCAG
ACCCGAGGCAACCAGCTGTGCAGCCTCATCTCAGGGATCATCCGGGCCTCTTCAGAGAGCAGCTATCCCA
CAGCAGAGAGTCAAGCTGAGGCTGAGCGAGCTCTGCGGGAAATGCGGGACCTCCTGATGAACTTGGGGCA
GGAGATCACCAGAGCCTGCGAAGACAAGAGGAGGCAGGATGAAGAAGAGGCCCAGGTAAAGCTGCAAGAG
GCACAGATGCAGCAGGGACCAGAGGCCCACAAAGAGCCCCCAGCTCCCAGCCAGGGCCCAGGAGGGAAAC
AGAATGAAGACCTCCAGGTGAAGGTACAAGACATTACAATGCAGTGGTACCAGCAGCTGCAGGATGCTTC
CATGCAGTGTGTGTTGACCTTTGAGGGCCTGACCAACAGCAAGGACAGTCAGGCCAAAAAGATAAAGATG
GACCTCCAGAAGGCTGCTACCATCCCAGTGAGCCAAATCTCTACCATTGCAGGCTCAAAACTGAAGGAGA
TCTTTGACAAGATCCACAGCCTGCTCTCTGGAAAACCTGTTCAATCTGGTGGGCGCTCTGTGTCTGTCAC
ACTTAACCCACAGGGGCTGGACTTTGTTCAATACAAACTGGCAGAGAAATTTGTGAAACAAGGCGAGGAG
GAAGTGGCCTCTCACCATGAAGCAGCATTCCCCATTGCAGTTGTGGCATCCGGGATCTGGGAGCTCCACC
CCAGAGTGGGGGACCTCATTCTTGCTCATCTACATAAGAAGTGTCCTTACTCTGTTCCTTTCTATCCCAC
TTTCAAGGAGGGAATGGCTTTGGAAGACTATCAGAGGATGCTTGGTTACCAAGTAAAGGATTCCAAAGTG
GAGCAGCAAGACAACTTTCTAAAACGCATGTCAGGGATGATCCGTCTCTACGCTGCTATCATCCAGCTCC
GGTGGCCATATGGAAACCAACAGGAGATTCACCCTCATGGCTTAAATCATGGATGGCGCTGGTTGGCACA
GATCTTAAACATGGAGCCCTTGTCAGATGTGACAGCCACCCTCCTCTTTGACTTCCTGGAGGTGTGTGGG
AATGCCCTCATGAAGCAATACCAGGTTCAGTTCTGGAAGATGCTAATTCTCATCAAAGAGGACTACTTTC
CCAGAATTGAAGCTATCACAAGCTCAGGACAGATGGGCTCCTTCATACGCCTCAAGCAGTTCTTGGAGAA
ATGTTTGCAACACAAGGACATTCCTGTCCCCAAGGGCTTTCTGACTTCCTCCTTCTGGCGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205354 protein sequence
Red=Cloning site Green=Tags(s)

MPSEGRCWETLKALRSSDKGRLCYYRDWLLRREDVLEECMSLPKLSSYSGWVVEHVLPHMQENQPLSETS
PSSTSASALDQPSFVPKSPDASSAFSPASPATPNGTKGKDESQHTESMVLQSSRGIKVEDCVRMYELVHR
MKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHR
HRAKILNLKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQHKALLKVDLAAFQ
TRGNQLCSLISGIIRASSESSYPTAESQAEAERALREMRDLLMNLGQEITRACEDKRRQDEEEAQVKLQE
AQMQQGPEAHKEPPAPSQGPGGKQNEDLQVKVQDITMQWYQQLQDASMQCVLTFEGLTNSKDSQAKKIKM
DLQKAATIPVSQISTIAGSKLKEIFDKIHSLLSGKPVQSGGRSVSVTLNPQGLDFVQYKLAEKFVKQGEE
EVASHHEAAFPIAVVASGIWELHPRVGDLILAHLHKKCPYSVPFYPTFKEGMALEDYQRMLGYQVKDSKV
EQQDNFLKRMSGMIRLYAAIIQLRWPYGNQQEIHPHGLNHGWRWLAQILNMEPLSDVTATLLFDFLEVCG
NALMKQYQVQFWKMLILIKEDYFPRIEAITSSGQMGSFIRLKQFLEKCLQHKDIPVPKGFLTSSFWRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001003722
ORF Size 2094 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001003722.1, NP_001003722
RefSeq Size 3350
RefSeq ORF 2097
Locus ID 2733
Cytogenetics 9q34.11
MW 79.9 kDa
Gene Summary This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "GLE1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit polyclonal antibody to GLE1 (GLE1 RNA export mediator homolog (yeast))
    • 100 ul

USD 415.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones