TJP2 (NM_004817) Human Tagged ORF Clone

CAT#: RC205295

Reviews ()
Write a review

TJP2 (Myc-DDK-tagged)-Human tight junction protein 2 (zona occludens 2) (TJP2), transcript variant 1


 Cited in 3 publications.

  "NM_004817" in other vectors (6)

USD 98.00

USD 800.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name TJP2 (NM_004817) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TJP2
Synonyms C9DUPq21.11; DFNA51; DUP9q21.11; PFIC4; X104; ZO2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205295 representing NM_004817
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGTGCGAGGAGACCGCGGGTTTCCACCCCGGCGGGAGCTGTCAGGTTGGCTCCGCGCCCCAGGCA
TGGAAGAGCTGATATGGGAACAGTACACTGTGACCCTACAAAAGGATTCCAAAAGAGGATTTGGAATTGC
AGTGTCCGGAGGCAGAGACAACCCCCACTTTGAAAATGGAGAAACGTCAATTGTCATTTCTGATGTGCTC
CCGGGTGGGCCTGCTGATGGGCTGCTCCAAGAAAATGACAGAGTGGTCATGGTCAATGGCACCCCCATGG
AGGATGTGCTTCATTCGTTTGCAGTTCAGCAGCTCAGAAAAAGTGGGAAGGTCGCTGCTATTGTGGTCAA
GAGGCCCCGGAAGGTCCAGGTGGCCGCACTTCAGGCCAGCCCTCCCCTGGATCAGGATGACCGGGCTTTT
GAGGTGATGGACGAGTTTGATGGCAGAAGTTTCCGGAGTGGCTACAGCGAGAGGAGCCGGCTGAACAGCC
ATGGGGGGCGCAGCCGCAGCTGGGAGGACAGCCCGGAAAGGGGGCGTCCCCATGAGCGGGCCCGGAGCCG
GGAGCGGGACCTCAGCCGGGACCGGAGCCGTGGCCGGAGCCTGGAGCGGGGCCTGGACCAAGACCATGCG
CGCACCCGAGACCGCAGCCGTGGCCGGAGCCTGGAGCGGGGCCTGGACCACGACTTTGGGCCATCCCGGG
ACCGGGACCGTGACCGCAGCCGCGGCCGGAGCATTGACCAGGACTACGAGCGAGCCTATCACCGGGCCTA
CGACCCAGACTACGAGCGGGCCTACAGCCCGGAGTACAGGCGCGGGGCCCGCCACGATGCCCGCTCTCGG
GGACCCCGAAGCCGCAGCCGCGAGCACCCGCACTCACGGAGCCCCAGCCCCGAGCCTAGGGGGCGGCCGG
GGCCCATCGGGGTCCTCCTGATGAAAAGCAGAGCGAACGAAGAGTATGGTCTCCGGCTTGGGAGTCAGAT
CTTCGTAAAGGAAATGACCCGAACGGGTCTGGCAACTAAAGATGGCAACCTTCACGAAGGAGACATAATT
CTCAAGATCAATGGGACTGTAACTGAGAACATGTCTTTAACGGATGCTCGAAAATTGATAGAAAAGTCAA
GAGGAAAACTACAGCTAGTGGTGTTGAGAGACAGCCAGCAGACCCTCATCAACATCCCGTCATTAAATGA
CAGTGACTCAGAAATAGAAGATATTTCAGAAATAGAGTCAAACCGATCATTTTCTCCAGAGGAGAGACGT
CATCAGTATTCTGATTATGATTATCATTCCTCAAGTGAGAAGCTGAAGGAAAGGCCAAGTTCCAGAGAGG
ACACGCCGAGCAGATTGTCCAGGATGGGTGCGACACCCACTCCCTTTAAGTCCACAGGGGATATTGCAGG
CACAGTTGTCCCAGAGACCAACAAGGAACCCAGATACCAAGAGGACCCCCCAGCTCCTCAACCAAAAGCA
GCCCCGAGAACTTTTCTTCGTCCTAGTCCTGAAGATGAAGCAATATATGGCCCTAATACCAAAATGGTAA
GGTTCAAGAAGGGAGACAGCGTGGGCCTCCGGTTGGCTGGTGGCAATGATGTCGGGATATTTGTTGCTGG
CATTCAAGAAGGGACCTCGGCGGAGCAGGAGGGCCTTCAAGAAGGAGACCAGATTCTGAAGGTGAACACA
CAGGATTTCAGAGGATTAGTGCGGGAGGATGCCGTTCTCTACCTGTTAGAAATCCCTAAAGGTGAAATGG
TGACCATTTTAGCTCAGAGCCGAGCTGATGTGTATAGAGACATCCTGGCTTGTGGCAGAGGGGATTCGTT
TTTTATAAGAAGCCACTTTGAATGTGAGAAGGAAACTCCACAGAGCCTGGCCTTCACCAGAGGGGAGGTC
TTCCGAGTGGTAGACACACTGTATGACGGCAAGCTGGGCAACTGGCTGGCTGTGAGGATTGGGAACGAGT
TGGAGAAAGGCTTAATCCCCAACAAGAGCAGAGCTGAACAAATGGCCAGTGTTCAAAATGCCCAGAGAGA
CAACGCTGGGGACCGGGCAGATTTCTGGAGAATGCGTGGCCAGAGGTCTGGGGTGAAGAAGAACCTGAGG
AAAAGTCGGGAAGACCTCACAGCTGTTGTGTCTGTCAGCACCAAGTTCCCAGCTTATGAGAGGGTTTTGC
TGCGAGAAGCTGGTTTCAAGAGACCTGTGGTCTTATTCGGCCCCATAGCTGATATAGCAATGGAAAAATT
GGCTAATGAGTTACCTGACTGGTTTCAAACTGCTAAAACGGAACCAAAAGATGCAGGATCTGAGAAATCC
ACTGGAGTGGTCCGGTTAAATACCGTGAGGCAAATTATTGAGCAGGATAAGCATGCACTACTGGATGTGA
CTCCGAAAGCTGTGGACCTGTTGAATTACACCCAGTGGTTCCCAATTGTGATTTTTTTCAACCCAGACTC
CAGACAAGGTGTCAAAACCATGAGACAAAGGTTAAATCCAACGTCCAACAAAAGTTCTCGAAAGTTATTT
GATCAAGCCAACAAGCTTAAAAAAACGTGTGCACACCTTTTTACAGCTACAATCAACCTAAATTCAGCCA
ATGATAGCTGGTTTGGCAGCTTAAAGGACACTATTCAGCATCAGCAAGGAGAAGCGGTTTGGGTCTCTGA
AGGAAAGATGGAAGGGATGGATGATGACCCCGAAGACCGCATGTCCTACTTAACCGCCATGGGCGCGGAC
TATCTGAGTTGCGACAGCCGCCTCATCAGTGACTTTGAAGACACGGACGGTGAAGGAGGCGCCTACACTG
ACAATGAGCTGGATGAGCCAGCCGAGGAGCCGCTGGTGTCGTCCATCACCCGCTCCTCGGAGCCGGTGCA
GCACGAGGAGAGCATAAGGAAACCCAGCCCAGAGCCACGAGCTCAGATGAGGAGGGCTGCTAGCAGCGAT
CAACTTAGGGACAATAGCCCGCCCCCAGCATTCAAGCCAGAGCCGCCCAAGGCCAAAACCCAGAACAAAG
AAGAATCCTATGACTTCTCCAAATCCTATGAATATAAGTCAAACCCCTCTGCCGTTGCTGGTAATGAAAC
TCCTGGGGCATCTACCAAAGGTTATCCTCCTCCTGTTGCAGCAAAACCTACCTTTGGGCGGTCTATACTG
AAGCCCTCCACTCCCATCCCTCCTCAAGAGGGTGAGGAGGTGGGAGAGAGCAGTGAGGAGCAAGATAATG
CTCCCAAATCAGTCCTGGGCAAAGTCAAAATATTTGAGAAGATGGATCACAAGGCCAGGTTACAGAGAAT
GCAGGAGCTCCAGGAAGCACAGAATGCAAGGATCGAAATTGCCCAGAAGCATCCTGATATCTATGCAGTT
CCAATCAAAACGCACAAGCCAGACCCTGGCACGCCCCAGCACACGAGTTCCAGACCCCCTGAGCCACAGA
AAGCTCCTTCCAGACCTTATCAGGATACCAGAGGAAGTTATGGCAGTGATGCCGAGGAGGAGGAGTACCG
CCAGCAGCTGTCAGAACACTCCAAGCGCGGTTACTATGGCCAGTCTGCCCGATACCGGGACACAGAATTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205295 representing NM_004817
Red=Cloning site Green=Tags(s)

MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVL
PGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAF
EVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHA
RTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSR
GPRSRSREHPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDII
LKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERR
HQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQEDPPAPQPKA
APRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNT
QDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEV
FRVVDTLYDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLR
KSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKS
TGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLF
DQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGAD
YLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSD
QLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSIL
KPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAV
PIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004817
ORF Size 3570 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004817.2, NM_004817.3, NP_004808.2
RefSeq Size 4618
RefSeq ORF 3573
Locus ID 9414
Cytogenetics 9q21.11
Domains SH3, PDZ, Guanylate_kin, GuKc
Protein Pathways Tight junction, Vibrio cholerae infection
MW 133.8 kDa
Gene Summary This gene encodes a zonula occluden that is a member of the membrane-associated guanylate kinase homolog family. The encoded protein functions as a component of the tight junction barrier in epithelial and endothelial cells and is necessary for proper assembly of tight junctions. Mutations in this gene have been identified in patients with hypercholanemia, and genomic duplication of a 270 kb region including this gene causes autosomal dominant deafness-51. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Citations (3)

Other Versions

Other products for "TJP2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit anti ZO-2 Polyclonal Antibody
    • 100 ug

USD 355.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools