EDIL3 (NM_005711) Human Tagged ORF Clone

CAT#: RC205282

EDIL3 (Myc-DDK-tagged)-Human EGF-like repeats and discoidin I-like domains 3 (EDIL3)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EDIL3 (NM_005711) Human Tagged ORF Clone
Symbol EDIL3
Synonyms DEL1
Vector pCMV6-Entry
Sequence Data
>RC205282 representing NM_005711
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCGCTCGGTAGCCGTCTGGCTCTTGGTCGGGCTCAGCCTCAGTGTCCCCCAGTTCGGCAAAGGTG
ATATTTGTGATCCCAATCCATGTGAAAATGGAGGTATCTGTTTGCCAGGATTGGCTGATGGTTCCTTTTC
CTGTGAGTGTCCAGATGGCTTCACAGACCCCAACTGTTCTAGTGTTGTGGAGGTTGCATCAGATGAAGAA
GAACCAACTTCAGCAGGTCCCTGCACTCCTAATCCATGCCATAATGGAGGAACCTGTGAAATAAGTGAAG
CATACCGAGGGGATACATTCATAGGCTATGTTTGTAAATGTCCCCGAGGATTTAATGGGATTCACTGTCA
GCACAACATAAATGAATGCGAAGTTGAGCCTTGCAAAAATGGTGGAATATGTACAGATCTTGTTGCTAAC
TATTCCTGTGAGTGCCCAGGCGAATTTATGGGAAGAAATTGTCAATACAAATGCTCAGGCCCACTGGGAA
TTGAAGGTGGAATTATATCAAACCAGCAAATCACAGCTTCCTCTACTCACCGAGCTCTTTTTGGACTCCA
AAAATGGTATCCCTACTATGCACGTCTTAATAAGAAGGGGCTTATAAATGCGTGGACAGCTGCAGAAAAT
GACAGATGGCCGTGGATTCAGATAAATTTGCAAAGGAAAATGAGAGTTACTGGTGTGATTACCCAAGGAG
CCAAGAGGATTGGAAGCCCAGAGTATATAAAATCCTACAAAATTGCCTACAGTAATGATGGAAAGACTTG
GGCAATGTACAAAGTGAAAGGCACCAATGAAGACATGGTGTTTCGTGGAAACATTGATAACAACACTCCA
TATGCTAACTCTTTCACACCCCCCATAAAAGCTCAGTATGTAAGACTCTATCCCCAAGTTTGTCGAAGAC
ATTGCACTTTGCGAATGGAACTTCTTGGCTGTGAACTGTCGGGTTGTTCTGAGCCTCTGGGTATGAAATC
AGGACATATACAAGACTATCAGATCACTGCCTCCAGCATCTTCAGAACGCTCAACATGGACATGTTCACT
TGGGAACCAAGGAAAGCTCGGCTGGACAAGCAAGGCAAAGTGAATGCCTGGACCTCTGGCCACAATGACC
AGTCACAATGGTTACAGGTGGATCTTCTTGTTCCAACCAAAGTGACTGGCATCATTACACAAGGAGCTAA
AGATTTTGGTCATGTACAGTTTGTTGGCTCCTACAAACTGGCTTACAGCAATGATGGAGAACACTGGACT
GTATACCAGGATGAAAAGCAAAGAAAAGATAAGGTTTTCCAGGGAAATTTTGACAATGACACTCACAGAA
AAAATGTCATCGACCCTCCCATCTATGCACGACACATAAGAATCCTTCCTTGGTCCTGGTACGGGAGGAT
CACATTGCGGTCAGAGCTGCTGGGCTGCACAGAGGAGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205282 representing NM_005711
Red=Cloning site Green=Tags(s)

MKRSVAVWLLVGLSLSVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEE
EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVAN
YSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAEN
DRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTP
YANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFT
WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005711
ORF Size 1440 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005711.1, NM_005711.2, NM_005711.3, NM_005711.4, NP_005702
RefSeq Size 2974
RefSeq ORF 1443
Locus ID 10085
Cytogenetics 5q14.3
Domains F5_F8_type_C, EGF_CA, EGF, EGF
Protein Families Secreted Protein, Druggable Genome
MW 53.6 kDa
Gene Summary Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)