GNPTG (NM_032520) Human Tagged ORF Clone

CAT#: RC205280

GNPTG (Myc-DDK-tagged)-Human N-acetylglucosamine-1-phosphate transferase, gamma subunit (GNPTG)

Change vector?

  • TrueORF®

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GNPTG (NM_032520) Human Tagged ORF Clone
Symbol GNPTG
Synonyms C16orf27; GNPTAG; LP2537; RJD9
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205280 representing NM_032520
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGGGCTGGCGCGGCTCCTGTTGCTCCTCGGGCTCTCGGCCGGCGGGCCCGCGCCGGCAGGTG
CAGCGAAGATGAAGGTGGTGGAGGAGCCCAACGCGTTTGGGGTGAACAACCCGTTCTTGCCTCAGGCCAG
TCGCCTCCAGGCCAAGAGGGATCCTTCACCCGTGTCTGGACCCGTGCATCTCTTCCGACTCTCGGGCAAG
TGCTTCAGCCTGGTGGAGTCCACGTACAAGTATGAGTTCTGCCCGTTCCACAACGTGACCCAGCACGAGC
AGACCTTCCGCTGGAACGCCTACAGTGGGATCCTCGGCATCTGGCACGAGTGGGAGATCGCCAACAACAC
CTTCACGGGCATGTGGATGAGGGACGGTGACGCCTGCCGTTCCCGGAGCCGGCAGAGCAAGGTGGAGCTG
GCGTGTGGAAAAAGCAACCGGCTGGCCCATGTGTCCGAGCCGAGCACCTGCGTCTACGCGCTGACGTTCG
AGACCCCCCTCGTCTGCCACCCCCACGCCTTGCTAGTGTACCCAACCCTGCCAGAGGCCCTGCAGCGGCA
GTGGGACCAGGTAGAGCAGGACCTGGCCGATGAGCTGATCACCCCCCAGGGCCATGAGAAGTTGCTGAGG
ACACTTTTTGAGGATGCTGGCTACTTAAAGACCCCAGAAAATGAACCCACCCAGCTGGAGGGAGGTCCTG
ACAGCTTGGGGTTTGAGACCCTGGAAAACTGCAGGAAGGCTCATAAAGAACTCTCAAAGGAGATCAAAAG
GCTGAAAGGTTTGCTCACCCAGCACGGCATCCCCTACACGAGGCCCACAGAAACTTCCAACTTGGAGCAC
TTGGGCCACGAGACGCCCAGAGCCAAGTCTCCAGAGCAGCTGCGGGGTGACCCAGGACTGCGTGGGAGTT
TG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205280 representing NM_032520
Red=Cloning site Green=Tags(s)

MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGK
CFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVEL
ACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLR
TLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEH
LGHETPRAKSPEQLRGDPGLRGSL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032520
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032520.1, NM_032520.2, NM_032520.3, NM_032520.4, NP_115909
RefSeq Size 1228
RefSeq ORF 918
Locus ID 84572
Cytogenetics 16p13.3
Protein Families Secreted Protein
MW 33.8 kDa
Gene Summary This gene encodes the gamma sunbunit of the N-acetylglucosamine-1-phosphotransferase complex. This hexameric complex, composed of alpha, beta and gamma subunits, catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker. This enzyme complex is necessary for targeting of lysosomal hydrolases to the lysosome. Mutations in the gene encoding the gamma subunit have been associated with mucolipidosis IIIC, also known as mucolipidosis III gamma.[provided by RefSeq, Feb 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations