TBK1 (NM_013254) Human Tagged ORF Clone

CAT#: RC205238

Reviews ()
Write a review

TBK1 (Myc-DDK-tagged)-Human TANK-binding kinase 1 (TBK1)



  "NM_013254" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TBK1
Synonyms FTDALS4; IIAE8; NAK; T2K
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205238 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAGCACTTCTAATCATCTGTGGCTTTTATCTGATATTTTAGGCCAAGGAGCTACTGCAAATGTCT
TTCGTGGAAGACATAAGAAAACTGGTGATTTATTTGCTATCAAAGTATTTAATAACATAAGCTTCCTTCG
TCCAGTGGATGTTCAAATGAGAGAATTTGAAGTGTTGAAAAAACTCAATCACAAAAATATTGTCAAATTA
TTTGCTATTGAAGAGGAGACAACAACAAGACATAAAGTACTTATTATGGAATTTTGTCCATGTGGGAGTT
TATACACTGTTTTAGAAGAACCTTCTAATGCCTATGGACTACCAGAATCTGAATTCTTAATTGTTTTGCG
AGATGTGGTGGGTGGAATGAATCATCTACGAGAGAATGGTATAGTGCACCGTGATATCAAGCCAGGAAAT
ATCATGCGTGTTATAGGGGAAGATGGACAGTCTGTGTACAAACTCACAGATTTTGGTGCAGCTAGAGAAT
TAGAAGATGATGAGCAGTTTGTTTCTCTGTATGGCACAGAAGAATATTTGCACCCTGATATGTATGAGAG
AGCAGTGCTAAGAAAAGATCATCAGAAGAAATATGGAGCAACAGTTGATCTTTGGAGCATTGGGGTAACA
TTTTACCATGCAGCTACTGGATCACTGCCATTTAGACCCTTTGAAGGGCCTCGTAGGAATAAAGAAGTGA
TGTATAAAATAATTACAGGAAAGCCTTCTGGTGCAATATCTGGAGTACAGAAAGCAGAAAATGGACCAAT
TGACTGGAGTGGAGACATGCCTGTTTCTTGCAGTCTTTCTCGGGGTCTTCAGGTTCTACTTACCCCTGTT
CTTGCAAACATCCTTGAAGCAGATCAGGAAAAGTGTTGGGGTTTTGACCAGTTTTTTGCAGAAACTAGTG
ATATACTTCACCGAATGGTAATTCATGTTTTTTCGCTACAACAAATGACAGCTCATAAGATTTATATACA
TAGCTATAATACTGCTACTATATTTCATGAACTGGTATATAAACAAACCAAAATTATTTCTTCAAATCAA
GAACTTATCTACGAAGGGCGACGCTTAGTCTTAGAACCTGGAAGGCTGGCACAACATTTCCCTAAAACTA
CTGAGGAAAACCCTATATTTGTAGTAAGCCGGGAACCTCTGGATACCATAGGATTAATATATGAAAAAAT
TTCCCTCCCTAAAGTACATCCACGTTATGATTTAGACGGGGATGCTAGCATGGCTAAGGCAATAACAGGG
GTTGTGTGTTATGCCTGCAGAATTGCCAGTACCTTACTGCTTTATCAGGAATTAATGCGAAAGGGGATAC
GATGGCTGATTGAATTAATTAAAGATGATTACAATGAAACTGTTCACAAAAAGACAGAAGTTGTGATCAC
ATTGGATTTCTGTATCAGAAACATTGAAAAAACTGTGAAAGTATATGAAAAGTTGATGAAGATCAACCTG
GAAGCGGCAGAGTTAGGTGAAATTTCAGACATACACACCAAATTGTTGAGACTTTCCAGTTCTCAGGGAA
CAATAGAAACCAGTCTTCAGGATATCGACAGCAGATTATCTCCAGGTGGATCACTGGCAGACGCATGGGC
ACATCAAGAAGGCACTCATCCGAAAGACAGAAATGTAGAAAAACTACAAGTCCTGTTAAATTGCATGACA
GAGATTTACTATCAGTTCAAAAAAGACCAAGCAGAACGTAGATTAGCTTATAATGAAGAACAAATCCACA
AATTTGATAAGCAAAAACTGTATTACCATGCCACAAAAGCTATGACGCACTTTACAGATGAATGTGTTAA
AAAGTATGAGGCATTTTTGAATAAGTCAGAAGAATGGATAAGAAAGATGCTTCATCTTAGGAAACAGTTA
TTATCGCTGACTAATCAGTGTTTTGATATTGAAGAAGAAGTATCAAAATATCAAGAATATACTAATGAGT
TACAAGAAACTCTGCCTCAGAAAATGTTTACAGCTTCCAGTGGAATCAAACATACCATGACCCCAATTTA
TCCAAGTTCTAACACATTAGTAGAAATGACTCTTGGTATGAAGAAATTAAAGGAAGAGATGGAAGGGGTG
GTTAAAGAACTTGCTGAAAATAACCACATTTTAGAAAGGTTTGGCTCTTTAACCATGGATGGTGGCCTTC
GCAACGTTGACTGTCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205238 protein sequence
Red=Cloning site Green=Tags(s)

MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKL
FAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGN
IMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVT
FYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPV
LANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQ
ELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLDTIGLIYEKISLPKVHPRYDLDGDASMAKAITG
VVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINL
EAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMT
EIYYQFKKDQAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQL
LSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGV
VKELAENNHILERFGSLTMDGGLRNVDCL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013254
ORF Size 2187 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013254.4
RefSeq Size 3098 bp
RefSeq ORF 2190 bp
Locus ID 29110
UniProt ID Q9UHD2
Cytogenetics 12q14.2
Domains pkinase, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
MW 83.6 kDa
Gene Summary The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. The protein encoded by this gene is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. [provided by RefSeq, Oct 2010]

Other Versions

Other products for "TBK1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Mouse Monoclonal NAK Antibody (108A429)
    • 100 ug

USD 457.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.