OGDHL (NM_018245) Human Tagged ORF Clone

CAT#: RC205225

OGDHL (Myc-DDK-tagged)-Human oxoglutarate dehydrogenase-like (OGDHL), nuclear gene encoding mitochondrial protein, transcript variant 1

Change vector?

USD 98

USD 800


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name OGDHL (NM_018245) Human Tagged ORF Clone
Symbol OGDHL
Synonyms FLJ10851
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205225 representing NM_018245
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCAGCTGAGGCTGCTGCCGTCCCGTCTTGGGGTGCAGGCTGCGAGGCTCCTGGCTGCACATGACG
TCCCGGTGTTTGGCTGGCGCAGCAGGTCCTCCGGGCCACCGGCCACCTTCCCAAGCAGCAAAGGTGGAGG
CGGCTCCAGTTACATGGAGGAGATGTACTTCGCCTGGTTGGAAAACCCCCAGAGTGTCCACAAGTCCTGG
GACAGCTTCTTCAGGGAAGCCAGCGAGGAAGCCTTTTCTGGCTCTGCTCAGCCACGGCCCCCTTCTGTTG
TCCATGAGAGCAGGTCTGCAGTCTCAAGTCGGACCAAGACCAGCAAATTGGTGGAGGACCACCTGGCTGT
GCAGTCCCTGATCCGGGCCTACCAGATCCGGGGTCACCATGTGGCCCAGCTGGACCCCCTGGGCATTCTG
GATGCAGACCTGGACTCCTTTGTGCCCTCAGACTTGATCACAACCATTGATAAACTGGCCTTCTATGACC
TTCAGGAGGCTGACCTTGATAAGGAGTTCCAGCTGCCGACAACCACCTTCATTGGGGGCTCTGAAAACAC
CCTTTCTCTGCGGGAGATCATTCGGCGCCTGGAGAACACCTACTGCCAGCACATTGGCCTGGAGTTCATG
TTCATCAACGATGTGGAGCAGTGCCAGTGGATCCGGCAGAAGTTTGAGACCCCTGGTGTGATGCAGTTCT
CCAGCGAGGAGAAGCGGACCCTGCTGGCCCGGCTAGTGCGCTCCATGAGGTTTGAAGACTTCCTGGCCCG
GAAATGGTCCTCAGAGAAGCGGTTTGGCCTGGAGGGCTGTGAAGTGATGATTCCTGCCCTCAAGACCATC
ATCGACAAATCCAGCGAGATGGGGATTGAGAATGTCATCTTGGGGATGCCACACAGGGGAAGGCTGAACG
TGCTGGCCAACGTGATCCGCAAGGACCTGGAGCAGATCTTCTGCCAGTTTGACCCCAAGCTGGAGGCGGC
GGACGAGGGCTCCGGGGATGTCAAGTACCACCTGGGCATGTACCATGAGAGGATCAACCGCGTCACCAAC
CGGAACATCACTCTGTCGCTGGTTGCCAACCCCTCCCACCTGGAGGCAGTGGACCCTGTGGTGCAGGGGA
AGACAAAGGCAGAGCAGTTCTACCGTGGAGATGCCCAGGGCAAGAAGGTCATGTCCATCCTGGTTCATGG
GGACGCCGCCTTTGCTGGCCAGGGCGTGGTATATGAGACCTTCCACCTGAGCGACCTGCCCTCCTACACG
ACCAATGGTACCGTGCACGTCGTCGTCAACAACCAGATTGGATTCACCACAGACCCCCGAATGGCCCGCT
CCTCACCATACCCGACCGACGTGGCCCGGGTGGTCAATGCGCCTATCTTCCATGTGAATGCAGATGACCC
AGAGGCTGTGATATATGTGTGCAGTGTGGCAGCCGAATGGAGAAACACTTTCAACAAAGATGTTGTCGTG
GACCTGGTCTGTTACCGCCGGCGTGGCCACAATGAGATGGACGAGCCCATGTTCACCCAGCTGCTCATGT
ACAAGCAGATCCACAGACAGGTGCCTGTGCTGAAGAAGTACGCAGACAAGCTGATTGCCGAGGGCACAGT
CACCCTGCAGGAGTTTGAGGAAGAAATTGCCAAATACGACCGGATCTGTGAGGAGGCTTATGGCAGGTCC
AAGGATAAAAAGATTCTGCATATAAAGCACTGGTTGAACTCCCCCTGGCCTGGCTTCTTCAACGTAGATG
GGGAGCCCAAGAGCATGACATGCCCAGCCACGGGGATCCCTGAGGACATGCTCACCCACATCGGCAGTGT
GGCCAGCTCTGTGCCCCTGGAGGACTTTAAGATCCACACTGGCCTCTCTCGCATTCTGCGGGGCCGTGCG
GACATGACCAAGAACCGGACGGTGGACTGGGCGTTGGCAGAGTACATGGCCTTTGGCTCCCTGCTGAAGG
AAGGCATCCACGTGCGGCTCAGCGGGCAGGATGTGGAGAGGGGCACATTCAGTCACCGGCACCATGTTCT
CCATGACCAGGAGGTTGACCGCAGGACGTGTGTGCCTATGAATCATCTCTGGCCTGACCAGGCCCCGTAC
ACCGTGTGCAACAGCTCCCTCTCGGAGTACGGAGTCCTGGGCTTTGAGCTGGGCTATGCCATGGCCAGCC
CCAATGCCCTGGTCCTCTGGGAGGCCCAGTTTGGGGACTTCCACAACACGGCCCAGTGCATCATCGACCA
GTTCATCAGCACCGGCCAGGCCAAGTGGGTGCGGCATAATGGCATTGTGCTGCTGCTGCCCCATGGCATG
GAAGGCATGGGCCCAGAGCACTCGTCAGCGAGGCCCGAAAGGTTCCTGCAGATGAGCAATGATGACTCGG
ATGCCTACCCTGCATTCACCAAGGACTTCGAGGTGAGCCAGCTCTATGACTGCAACTGGATCGTGGTCAA
CTGCTCCACACCGGCCAACTACTTCCACGTGCTGCGCCGGCAGATCCTGCTGCCCTTCCGCAAGCCGCTG
ATTATCTTCACACCTAAATCTCTGCTGAGGCACCCAGAGGCCAAGTCCAGCTTTGACCAAATGGTATCCG
GGACCAGCTTCCAGCGGGTGATTCCTGAAGATGGGGCCGCAGCACGGGCCCCTGAGCAGGTGCAGCGGCT
CATCTTCTGCACGGGAAAGGTGTACTATGACCTGGTGAAGGAGCGGAGCAGCCAGGACCTGGAGGAGAAA
GTGGCCATCACGCGCCTGGAGCAGATCTCTCCATTCCCCTTCGACCTGATCAAGCAGGAGGCAGAGAAGT
ACCCAGGTGCGGAGCTGGCCTGGTGTCAGGAGGAGCACAAGAACATGGGCTACTATGACTACATCAGCCC
ACGCTTCATGACCATCCTGAGGCGCGCACGGCCCATATGGTATGTTGGCCGGGACCCAGCGGCTGCACCA
GCCACAGGAAACAGGAACACTCACCTGGTGTCACTGAAGAAGTTTCTGGATACTGCCTTCAATCTCCAGG
CCTTTGAGGGCAAGACATTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205225 representing NM_018245
Red=Cloning site Green=Tags(s)

MSQLRLLPSRLGVQAARLLAAHDVPVFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSW
DSFFREASEEAFSGSAQPRPPSVVHESRSAVSSRTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIL
DADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTFIGGSENTLSLREIIRRLENTYCQHIGLEFM
FINDVEQCQWIRQKFETPGVMQFSSEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTI
IDKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTN
RNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTFNKDVVV
DLVCYRRRGHNEMDEPMFTQLLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRS
KDKKILHIKHWLNSPWPGFFNVDGEPKSMTCPATGIPEDMLTHIGSVASSVPLEDFKIHTGLSRILRGRA
DMTKNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPY
TVCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGM
EGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPL
IIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVKERSSQDLEEK
VAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILRRARPIWYVGRDPAAAP
ATGNRNTHLVSLKKFLDTAFNLQAFEGKTF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018245
ORF Size 3030 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018245.1, NM_018245.2, NP_060715
RefSeq Size 3682
RefSeq ORF 3033
Locus ID 55753
Cytogenetics 10q11.23
Protein Pathways Citrate cycle (TCA cycle), Lysine degradation, Tryptophan metabolism, Metabolic pathways
MW 114.3 kDa
Gene Summary The protein encoded by this gene is similar to oxoglutarate dehydrogenase (OGDH) of the OGDH complex, which degrades glucose and glutamate. This gene encodes several isoforms, including some that appear to localize to mitochondria. The encoded protein down-regulates the AKT signaling cascade and can suppress the growth of cervical cancer cells. [provided by RefSeq, Dec 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations