IFNAR1 (NM_000629) Human Tagged ORF Clone

CAT#: RC205141

IFNAR1 (Myc-DDK-tagged)-Human interferon (alpha, beta and omega) receptor 1 (IFNAR1)

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name IFNAR1 (NM_000629) Human Tagged ORF Clone
Symbol IFNAR1
Synonyms AVP; IFN-alpha-REC; IFNAR; IFNBR; IFRC
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205141 representing NM_000629
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGTCGTCCTCCTGGGCGCGACGACCCTAGTGCTCGTCGCCGTGGCGCCATGGGTGTTGTCCGCAG
CCGCAGGTGGAAAAAATCTAAAATCTCCTCAAAAAGTAGAGGTCGACATCATAGATGACAACTTTATCCT
GAGGTGGAACAGGAGCGATGAGTCTGTCGGGAATGTGACTTTTTCATTCGATTATCAAAAAACTGGGATG
GATAATTGGATAAAATTGTCTGGGTGTCAGAATATTACTAGTACCAAATGCAACTTTTCTTCACTCAAGC
TGAATGTTTATGAAGAAATTAAATTGCGTATAAGAGCAGAAAAAGAAAACACTTCTTCATGGTATGAGGT
TGACTCATTTACACCATTTCGCAAAGCTCAGATTGGTCCTCCAGAAGTACATTTAGAAGCTGAAGATAAG
GCAATAGTGATACACATCTCTCCTGGAACAAAAGATAGTGTTATGTGGGCTTTGGATGGTTTAAGCTTTA
CATATAGCTTAGTTATCTGGAAAAACTCTTCAGGTGTAGAAGAAAGGATTGAAAATATTTATTCCAGACA
TAAAATTTATAAACTCTCACCAGAGACTACTTATTGTCTAAAAGTTAAAGCAGCACTACTTACGTCATGG
AAAATTGGTGTCTATAGTCCAGTACATTGTATAAAGACCACAGTTGAAAATGAACTACCTCCACCAGAAA
ATATAGAAGTCAGTGTCCAAAATCAGAACTATGTTCTTAAATGGGATTATACATATGCAAACATGACCTT
TCAAGTTCAGTGGCTCCACGCCTTTTTAAAAAGGAATCCTGGAAACCATTTGTATAAATGGAAACAAATA
CCTGACTGTGAAAATGTCAAAACTACCCAGTGTGTCTTTCCTCAAAACGTTTTCCAAAAAGGAATTTACC
TTCTCCGCGTACAAGCATCTGATGGAAATAACACATCTTTTTGGTCTGAAGAGATAAAGTTTGATACTGA
AATACAAGCTTTCCTACTTCCTCCAGTCTTTAACATTAGATCCCTTAGTGATTCATTCCATATCTATATC
GGTGCTCCAAAACAGTCTGGAAACACGCCTGTGATCCAGGATTATCCACTGATTTATGAAATTATTTTTT
GGGAAAACACTTCAAATGCTGAGAGAAAAATTATCGAGAAAAAAACTGATGTTACAGTTCCTAATTTGAA
ACCACTGACTGTATATTGTGTGAAAGCCAGAGCACACACCATGGATGAAAAGCTGAATAAAAGCAGTGTT
TTTAGTGACGCTGTATGTGAGAAAACAAAACCAGGAAATACCTCTAAAATTTGGCTTATAGTTGGAATTT
GTATTGCATTATTTGCTCTCCCGTTTGTCATTTATGCTGCGAAAGTCTTCTTGAGATGCATCAATTATGT
CTTCTTTCCATCACTTAAACCTTCTTCCAGTATAGATGAGTATTTCTCTGAACAGCCATTGAAGAATCTT
CTGCTTTCAACTTCTGAGGAACAAATCGAAAAATGTTTCATAATTGAAAATATAAGCACAATTGCTACAG
TAGAAGAAACTAATCAAACTGATGAAGATCATAAAAAATACAGTTCCCAAACTAGCCAAGATTCAGGAAA
TTATTCTAATGAAGATGAAAGCGAAAGTAAAACAAGTGAAGAACTACAGCAGGACTTTGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205141 representing NM_000629
Red=Cloning site Green=Tags(s)

MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGM
DNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDK
AIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSW
KIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQI
PDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYI
GAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNL
LLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000629
ORF Size 1671 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000629.1, NM_000629.2, NP_000620
RefSeq Size 6099
Locus ID 3454
Cytogenetics 21q22.11
Protein Families Transmembrane, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity
MW 63.53 kDa
Gene Summary The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.