SNRPG (NM_003096) Human Tagged ORF Clone
CAT#: RC205113
SNRPG (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein polypeptide G (SNRPG)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_003096" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | SNRPG |
Synonyms | Sm-G; SMG |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205113 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCAAAGCTCACCCTCCCGAGTTGAAAAAATTTATGGACAAGAAGTTATCATTGAAATTAAATGGTG GCAGACATGTCCAAGGAATATTGCGGGGATTTGATCCCTTTATGAACCTTGTGATAGATGAATGTGTGGA GATGGCGACTAGTGGACAACAGAACAATATTGGAATGGTGGTAATACGAGGAAATAGTATCATCATGTTA GAAGCCTTGGAACGAGTA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205113 protein sequence
Red=Cloning site Green=Tags(s) MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML EALERV myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003096 |
ORF Size | 228 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003096.4 |
RefSeq Size | 606 bp |
RefSeq ORF | 231 bp |
Locus ID | 6637 |
UniProt ID | P62308 |
Cytogenetics | 2p13.3 |
Domains | Sm |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
MW | 8.5 kDa |
Gene Summary | The protein encoded by this gene is a component of the U1, U2, U4, and U5 small nuclear ribonucleoprotein complexes, precursors of the spliceosome. The encoded protein may also be a part of the U7 small nuclear ribonucleoprotein complex, which participates in the processing of the 3' end of histone transcripts. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205113L1 | Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide G (SNRPG), Myc-DDK-tagged |
USD 450.00 |
|
RC205113L2 | Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide G (SNRPG), mGFP tagged |
USD 450.00 |
|
RC205113L3 | Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide G (SNRPG), Myc-DDK-tagged |
USD 450.00 |
|
RC205113L4 | Lenti ORF clone of Human small nuclear ribonucleoprotein polypeptide G (SNRPG), mGFP tagged |
USD 450.00 |
|
RG205113 | SNRPG (tGFP-tagged) - Human small nuclear ribonucleoprotein polypeptide G (SNRPG) |
USD 350.00 |
|
SC118196 | SNRPG (untagged)-Human small nuclear ribonucleoprotein polypeptide G (SNRPG) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review