PDCD10 (NM_145860) Human Tagged ORF Clone

CAT#: RC205095

Reviews ()
Write a review

PDCD10 (Myc-DDK-tagged)-Human programmed cell death 10 (PDCD10), transcript variant 3



  "NM_145860" in other vectors (6)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PDCD10 (NM_145860) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PDCD10
Synonyms CCM3; TFAR15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205095 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGATGACAATGGAAGAGATGAAGAATGAAGCTGAGACCACATCCATGGTTTCTATGCCCCTCTATG
CAGTCATGTATCCTGTGTTTAATGAGCTAGAACGAGTAAATCTGTCTGCAGCCCAGACACTGAGAGCCGC
TTTCATCAAGGCTGAAAAAGAAAATCCAGGTCTCACACAAGACATCATTATGAAAATTTTAGAGAAAAAA
AGCGTGGAAGTTAACTTCACGGAGTCCCTTCTTCGTATGGCAGCTGATGATGTAGAAGAGTATATGATTG
AACGACCAGAGCCAGAATTCCAAGACCTAAACGAAAAGGCACGAGCACTTAAACAAATTCTCAGTAAGAT
CCCAGATGAGATCAATGACAGAGTGAGGTTTCTGCAGACAATCAAGGATATAGCTAGTGCAATAAAAGAA
CTTCTTGATACAGTGAATAATGTCTTCAAGAAATATCAATACCAGAACCGCAGGGCACTTGAACACCAAA
AGAAAGAATTTGTAAAGTACTCCAAAAGTTTCAGTGATACTCTGAAAACGTATTTTAAAGATGGCAAGGC
AATAAATGTGTTCGTAAGTGCCAACCGACTAATTCATCAAACCAACTTAATACTTCAGACCTTCAAAACT
GTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205095 protein sequence
Red=Cloning site Green=Tags(s)

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK
SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE
LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
VA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_145860
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_145860.1, NP_665859.1
RefSeq Size 1212 bp
RefSeq ORF 639 bp
Locus ID 11235
Cytogenetics 3q26.1
Protein Families Druggable Genome
MW 24.7 kDa
Gene Summary This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PDCD10"
Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-PDCD10 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools