ATP5PB (NM_001688) Human Tagged ORF Clone

CAT#: RC205088

Reviews ()
Write a review

ATP5F1 (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 (ATP5F1), nuclear gene encoding mitochondrial protein



  "NM_001688" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATP5PB (NM_001688) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATP5PB
Synonyms ATP5F1; PIG47
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205088 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCCCGGGTGGTACTTTCCGCCGCCGCCACAGCGGCCCCCTCTCTGAAGAATGCAGCCTTCCTAG
GTCCAGGGGTATTGCAGGCAACAAGGACCTTTCATACAGGGCAGCCACACCTTGTCCCTGTACCACCTCT
TCCTGAATACGGAGGAAAAGTTCGTTATGGACTGATCCCTGAGGAATTCTTCCAGTTTCTTTATCCTAAA
ACTGGTGTAACAGGACCCTATGTACTCGGAACTGGGCTTATCTTGTACGCTTTATCCAAAGAAATATATG
TGATTAGCGCAGAGACCTTCACTGCCCTATCAGTACTAGGTGTAATGGTCTATGGAATTAAAAAATATGG
TCCCTTTGTTGCAGACTTTGCTGATAAACTCAATGAGCAAAAACTTGCCCAACTAGAAGAGGCGAAGCAG
GCTTCCATCCAACACATCCAGAATGCAATTGATACGGAGAAGTCACAACAGGCACTGGTTCAGAAGCGCC
ATTACCTTTTTGATGTGCAAAGGAATAACATTGCTATGGCTTTGGAAGTTACTTACCGGGAACGACTGTA
TAGAGTATATAAGGAAGTAAAGAATCGCCTGGACTATCATATATCTGTGCAGAACATGATGCGTCGAAAG
GAACAAGAACACATGATAAATTGGGTGGAGAAGCACGTGGTGCAAAGCATCTCCACACAGCAGGAAAAGG
AGACAATTGCCAAGTGCATTGCGGACCTAAAGCTGCTGGCAAAGAAGGCTCAAGCACAGCCAGTTATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205088 protein sequence
Red=Cloning site Green=Tags(s)

MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPK
TGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQ
ASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRK
EQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001688
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001688.1, NM_001688.2, NM_001688.3, NM_001688.4, NP_001679.2
RefSeq Size 2116 bp
RefSeq ORF 771 bp
Locus ID 515
Cytogenetics 1p13.2
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
MW 28.9 kDa
Gene Summary This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ATP5PB"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-ATP5F1 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools