FXYD2 (NM_001680) Human Tagged ORF Clone
FXYD2 (Myc-DDK-tagged)-Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a
"NM_001680" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | FXYD2 |
Synonyms | ATP1G1; HOMG2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205076 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTGGGTTGTCGATGGACGGTGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGACTATG AGACCGTTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAG CAGAAGATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAAATCAATGAAGATGAGCCG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205076 protein sequence
Red=Cloning site Green=Tags(s) MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001680 |
ORF Size | 198 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001680.5 |
RefSeq Size | 584 bp |
RefSeq ORF | 201 bp |
Locus ID | 486 |
UniProt ID | P54710 |
Cytogenetics | 11q23.3 |
Domains | ATP1G1_PLM_MAT8 |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
MW | 7.3 kDa |
Gene Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes the sodium/potassium-transporting ATPase subunit gamma. Mutations in this gene have been associated with Renal Hypomagnesemia-2. Alternatively spliced transcript variants have been described. Read-through transcripts have been observed between this locus and the upstream FXYD domain-containing ion transport regulator 6 (FXYD6, GeneID 53826) locus.[provided by RefSeq, Feb 2011] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
cDNA Clone Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205076L1 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, Myc-DDK-tagged |
USD 768.00 |
|
RC205076L2 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, mGFP tagged |
USD 768.00 |
|
RC205076L3 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, Myc-DDK-tagged |
USD 768.00 |
|
RC205076L4 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a, mGFP tagged |
USD 768.00 |
|
RG205076 | FXYD2 (GFP-tagged) - Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a |
USD 517.00 |
|
SC121946 | FXYD2 (untagged)-Human FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a |
USD 429.00 |
USD 165.00
USD 627.00
USD 149.00
USD 55.00