FBXO6 (NM_018438) Human Tagged ORF Clone

CAT#: RC205063

FBXO6 (Myc-DDK-tagged)-Human F-box protein 6 (FBXO6)

Product Images

Circular map for RC205063

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY FBXO6 (Cat# RC205063, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FBXO6 (Cat# TA810333)(1:2000). Positive lysates LY412992 (100ug) and LC412992 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY412992) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC205063 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified FBXO6 protein (Cat# TP305063). The protein was produced from HEK293T cells transfected with FBXO6 cDNA clone (Cat# RC205063) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: FBXO6
• Synonyms: FBG2; FBS2; FBX6; Fbx6b
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205063 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGATGCTCCCCACTCCAAAGCAGCCCTGGACAGCATTAACGAGCTGCCCGAGAACATCCTGCTGGAGC
  TGTTCACGCACGTGCCCGCCCGCCAGCTGCTGCTGAACTGCCGCCTGGTCTGCAGCCTCTGGCGGGACCT
  CATCGACCTCATGACCCTCTGGAAACGCAAGTGCCTGCGAGAGGGCTTCATCACCAAGGACTGGGACCAG
  CCCGTGGCCGACTGGAAAATCTTCTACTTCCTACGGAGCCTGCATAGGAACCTCCTGCGCAACCCGTGTG
  CTGAAGAGGATATGTTTGCATGGCAAATTGATTTCAATGGTGGGGACCGCTGGAAGGTGGAGAGCCTCCC
  TGGAGCCCACGGGACAGATTTTCCTGACCCCAAAGTCAAGAAGTATTTTGTCACATCCTACGAAATGTGC
  CTCAAGTCCCAGCTGGTGGACCTTGTAGCCGAGGGCTACTGGGAGGAGCTACTAGACACATTCCGGCCGG
  ACATCGTGGTTAAGGACTGGTTTGCTGCCAGAGCCGACTGTGGCTGCACCTACCAACTCAAAGTGCAGCT
  GGCCTCGGCTGACTACTTCGTGTTGGCCTCCTTCGAGCCCCCACCTGTGACCATCCAACAGTGGAACAAT
  GCCACATGGACAGAGGTCTCCTACACCTTCTCAGACTACCCCCGGGGTGTCCGCTACATCCTCTTCCAGC
  ATGGGGGCAGGGACACCCAGTACTGGGCAGGCTGGTATGGGCCCCGAGTCACCAACAGCAGCATTGTCGT
  CAGCCCCAAGATGACCAGGAACCAGGCCTCCTCCGAGGCTCAGCCTGGGCAGAAGCATGGACAGGAGGAG
  GCTGCCCAATCGCCCTACCGAGCTGTTGTCCAGATTTTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205063 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQ
  PVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMC
  LKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNN
  ATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEE
  AAQSPYRAVVQIF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_018438
• ORF Size: 879 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_018438.6
• RefSeq Size: 1565 bp
• RefSeq ORF: 882 bp
• Locus ID: 26270
• UniProt ID: Q9NRD1
• Cytogenetics: 1p36.22
• Domains: F-box, FBA
• Protein Families: Druggable Genome
• MW: 33.9 kDa
• Gene Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class, and its C-terminal region is highly similar to that of rat NFB42 (neural F Box 42 kDa) which may be involved in the control of the cell cycle. [provided by RefSeq, Jul 2008]