MCEE (NM_032601) Human Tagged ORF Clone

CAT#: RC205018

MCEE (Myc-DDK-tagged)-Human methylmalonyl CoA epimerase (MCEE)

Product Images

Circular map for RC205018

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY MCEE (Cat# RC205018, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MCEE (Cat# TA808532)(1:2000). Positive lysates LY403176 (100ug) and LC403176 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY403176) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC205018 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: MCEE
• Synonyms: GLOD2; MCE
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC205018 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGCGGGTGCTGAAGGCTGCAGCCGCGAATGCCGTAGGGCTTTTTTCCAGACTTCAAGCTCCCATTC
  CAACAGTAAGAGCTTCTTCCACATCACAGCCCTTGGATCAAGTGACAGGTTCTGTGTGGAACCTGGGTCG
  ACTCAACCATGTAGCCATAGCAGTGCCAGATTTGGAAAAGGCTGCAGCATTTTATAAGAATATTCTGGGG
  GCCCAGGTAAGTGAAGCGGTCCCTCTTCCTGAACATGGAGTATCTGTTGTTTTTGTCAACCTGGGAAATA
  CCAAGATGGAACTGCTTCATCCATTGGGACTTGACAGTCCAATTGCAGGTTTTCTGCAGAAAAACAAGGC
  TGGAGGAATGCATCACATCTGCATCGAGGTGGATAATATTAATGCAGCTGTGATGGATTTGAAAAAAAAG
  AAGATCCGCAGTCTAAGTGAAGAGGTCAAAATAGGAGCACATGGAAAACCAGTGATTTTTCTCCATCCTA
  AAGACTGTGGTGGAGTCCTTGTGGAACTGGAGCAAGCT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC205018 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILG
  AQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKK
  KIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_032601
• ORF Size: 528 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_032601.2, NP_115990.2
• RefSeq Size: 875 bp
• RefSeq ORF: 531 bp
• Locus ID: 84693
• UniProt ID: Q96PE7
• Cytogenetics: 2p13.3
• Protein Pathways: Metabolic pathways, Propanoate metabolism, Valine, leucine and isoleucine degradation
• MW: 18.7 kDa
• Gene Summary: The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria. [provided by RefSeq, Jul 2008]