MCEE (NM_032601) Human Tagged ORF Clone

CAT#: RC205018

Reviews ()
Write a review

MCEE (Myc-DDK-tagged)-Human methylmalonyl CoA epimerase (MCEE)

  View "NM_032601" in other vectors (10)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name MCEE (NM_032601) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MCEE
Synonyms GLOD2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC205018 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCGGGTGCTGAAGGCTGCAGCCGCGAATGCCGTAGGGCTTTTTTCCAGACTTCAAGCTCCCATTC
CAACAGTAAGAGCTTCTTCCACATCACAGCCCTTGGATCAAGTGACAGGTTCTGTGTGGAACCTGGGTCG
ACTCAACCATGTAGCCATAGCAGTGCCAGATTTGGAAAAGGCTGCAGCATTTTATAAGAATATTCTGGGG
GCCCAGGTAAGTGAAGCGGTCCCTCTTCCTGAACATGGAGTATCTGTTGTTTTTGTCAACCTGGGAAATA
CCAAGATGGAACTGCTTCATCCATTGGGACTTGACAGTCCAATTGCAGGTTTTCTGCAGAAAAACAAGGC
TGGAGGAATGCATCACATCTGCATCGAGGTGGATAATATTAATGCAGCTGTGATGGATTTGAAAAAAAAG
AAGATCCGCAGTCTAAGTGAAGAGGTCAAAATAGGAGCACATGGAAAACCAGTGATTTTTCTCCATCCTA
AAGACTGTGGTGGAGTCCTTGTGGAACTGGAGCAAGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205018 protein sequence
Red=Cloning site Green=Tags(s)

MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILG
AQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKK
KIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032601
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_032601.1, NM_032601.2, NM_032601.3, NP_115990.2
RefSeq Size 875
RefSeq ORF 531
Locus ID 84693
Cytogenetics 2p13.3
Protein Pathways Metabolic pathways, Propanoate metabolism, Valine, leucine and isoleucine degradation
MW 18.7 kDa
Gene Summary The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "MCEE"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


MCEE mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones