ATP5PO (NM_001697) Human Tagged ORF Clone

CAT#: RC204991

Reviews ()
Write a review

ATP5O (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein



  "NM_001697" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ATP5PO (NM_001697) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ATP5PO
Synonyms ATP5O; ATPO; HMC08D05; OSCP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204991 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCCCAGCAGTGTCCGGGCTCTCCCGGCAGGTGCGATGCTTCAGTACCTCTGTGGTCAGACCAT
TTGCCAAGCTTGTGAGGCCTCCTGTTCAGGTATACGGTATTGAAGGTCGCTATGCCACAGCTCTTTATTC
TGCTGCATCAAAACAGAATAAGCTGGAGCAAGTAGAAAAGGAGTTGTTGAGAGTAGCACAAATCCTGAAG
GAACCCAAAGTGGCTGCTTCTGTTTTGAATCCCTATGTGAAGCGTTCCATTAAAGTGAAAAGCCTAAATG
ACATCACAGCAAAAGAGAGGTTCTCTCCCCTCACTACCAACCTGATCAATTTGCTTGCTGAAAATGGTCG
ATTAAGCAATACCCAAGGAGTCGTTTCTGCCTTTTCTACCATGATGAGTGTCCATCGCGGAGAGGTACCT
TGCACAGTGACCTCTGCATCTCCTTTAGAAGAAGCCACACTCTCTGAATTAAAAACTGTCCTCAAGAGCT
TCCTAAGTCAAGGCCAAGTATTGAAATTGGAGGCTAAGACTGATCCGTCAATCTTGGGTGGAATGATTGT
GCGCATTGGCGAGAAATATGTTGACATGTCTGTCAAGACCAAGATTCAGAAGCTGGGCAGGGCTATGCGG
GAGATTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204991 protein sequence
Red=Cloning site Green=Tags(s)

MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK
EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP
CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR
EIV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001697
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001697.1, NM_001697.2, NP_001688.1
RefSeq Size 815 bp
RefSeq ORF 642 bp
Locus ID 539
Cytogenetics 21q22.11
Domains OSCP
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
MW 23.3 kDa
Gene Summary The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ATP5PO"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ATP5O mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools