ATP5O (NM_001697) Human Tagged ORF Clone

CAT#: RC204991

ATP5O (Myc-DDK-tagged)-Human ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit (ATP5O), nuclear gene encoding mitochondrial protein

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ATP5O (NM_001697) Human Tagged ORF Clone
Symbol ATP5O
Synonyms ATPO; HMC08D05; OSCP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204991 representing NM_001697
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCCCCAGCAGTGTCCGGGCTCTCCCGGCAGGTGCGATGCTTCAGTACCTCTGTGGTCAGACCAT
TTGCCAAGCTTGTGAGGCCTCCTGTTCAGGTATACGGTATTGAAGGTCGCTATGCCACAGCTCTTTATTC
TGCTGCATCAAAACAGAATAAGCTGGAGCAAGTAGAAAAGGAGTTGTTGAGAGTAGCACAAATCCTGAAG
GAACCCAAAGTGGCTGCTTCTGTTTTGAATCCCTATGTGAAGCGTTCCATTAAAGTGAAAAGCCTAAATG
ACATCACAGCAAAAGAGAGGTTCTCTCCCCTCACTACCAACCTGATCAATTTGCTTGCTGAAAATGGTCG
ATTAAGCAATACCCAAGGAGTCGTTTCTGCCTTTTCTACCATGATGAGTGTCCATCGCGGAGAGGTACCT
TGCACAGTGACCTCTGCATCTCCTTTAGAAGAAGCCACACTCTCTGAATTAAAAACTGTCCTCAAGAGCT
TCCTAAGTCAAGGCCAAGTATTGAAATTGGAGGCTAAGACTGATCCGTCAATCTTGGGTGGAATGATTGT
GCGCATTGGCGAGAAATATGTTGACATGTCTGTCAAGACCAAGATTCAGAAGCTGGGCAGGGCTATGCGG
GAGATTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204991 representing NM_001697
Red=Cloning site Green=Tags(s)

MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILK
EPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVP
CTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMR
EIV

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001697
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001697.1, NM_001697.2, NP_001688
RefSeq Size 815
RefSeq ORF 642
Locus ID 539
Cytogenetics 21q22.11
Domains OSCP
Protein Pathways Oxidative phosphorylation, Metabolic pathways, Alzheimer's disease, Parkinson's disease, Huntington's disease
MW 23.28 kDa
Gene Summary The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)