SEC11A (NM_014300) Human Tagged ORF Clone

CAT#: RC204971

Reviews ()
Write a review

SEC11A (Myc-DDK-tagged)-Human SEC11 homolog A (S. cerevisiae) (SEC11A)


  "NM_014300" in other vectors (7)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name SEC11A (NM_014300) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEC11A
Synonyms 1810012E07Rik; SEC11L1; sid2895; SPC18; SPCS4A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCTCTAGACTTTTTGGACGATGTGCGGCGGATGAACAAGCGGCAGCTCTATTATCAAGTCCTAA
ATTTTGGAATGATTGTCTCATCGGCACTAATGATCTGGAAGGGGTTAATGGTAATAACTGGAAGTGAAAG
TCCGATTGTAGTGGTGCTCAGTGGCAGCATGGAACCTGCATTTCATAGAGGAGATCTTCTCTTTCTAACA
AATCGAGTTGAAGATCCCATACGAGTGGGAGAAATTGTTGTTTTTAGGATAGAAGGAAGAGAGATTCCTA
TAGTTCACCGAGTCTTGAAGATTCATGAAAAGCAAAATGGGCATATCAAGTTTTTGACCAAAGGAGATAA
TAATGCGGTTGATGACCGAGGCCTCTATAAACAAGGACAACATTGGCTAGAGAAAAAAGATGTTGTGGGG
AGAGCCAGGGGATTTGTTCCTTATATTGGAATTGTGACGATCCTCATGAATGACTATCCTAAATTTAAGT
ATGCAGTTCTCTTTTTGCTGGGTTTATTCGTGCTGGTTCATCGTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204971 protein sequence
Red=Cloning site Green=Tags(s)

MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLT
NRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVG
RARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014300
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014300.1, NM_014300.2, NM_014300.3, NP_055115.1
RefSeq Size 1424
RefSeq ORF 540
Locus ID 23478
Cytogenetics 15q25.2-q25.3
Domains Peptidase_S26
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Protein export
MW 20.6 kDa
Gene Summary This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. [provided by RefSeq, Dec 2012]

Other Versions

Other products for "SEC11A"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


SEC11A mouse monoclonal antibody,clone OTI1A12
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools