ADH5 (NM_000671) Human Tagged ORF Clone

CAT#: RC204903

Reviews ()
Write a review

ADH5 (Myc-DDK-tagged)-Human alcohol dehydrogenase 5 (class III), chi polypeptide (ADH5)



  "NM_000671" in other vectors (7)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ADH5 (NM_000671) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADH5
Synonyms ADH-3; ADHX; FALDH; FDH; GSH-FDH; GSNOR; HEL-S-60p
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204903 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAACGAGGTTATCAAGTGCAAGGCTGCAGTTGCTTGGGAGGCTGGAAAGCCTCTCTCCATAGAGG
AGATAGAGGTGGCACCCCCAAAGGCTCATGAAGTTCGAATCAAGATCATTGCCACTGCGGTTTGCCACAC
CGATGCCTATACCCTGAGTGGAGCTGATCCTGAGGGTTGTTTTCCAGTGATCTTGGGACATGAAGGTGCT
GGAATTGTGGAAAGTGTTGGTGAGGGAGTTACTAAGCTGAAGGCGGGTGACACTGTCATCCCACTTTACA
TCCCACAGTGTGGAGAATGCAAATTTTGTCTAAATCCTAAAACTAACCTTTGCCAGAAGATAAGAGTCAC
TCAAGGGAAAGGATTAATGCCAGATGGTACCAGCAGATTTACTTGCAAAGGAAAGACAATTTTGCATTAC
ATGGGAACCAGCACATTTTCTGAATACACAGTTGTGGCTGATATCTCTGTTGCTAAAATAGATCCTTTAG
CACCTTTGGATAAAGTCTGCCTTCTAGGTTGTGGCATTTCAACCGGTTATGGTGCTGCTGTGAACACTGC
CAAGTTGGAGCCTGGCTCTGTTTGTGCCGTCTTTGGTCTGGGAGGAGTCGGATTGGCAGTTATCATGGGC
TGTAAAGTGGCTGGTGCTTCCCGGATCATTGGTGTGGACATCAATAAAGATAAATTTGCAAGGGCCAAAG
AGTTTGGAGCCACTGAATGTATTAACCCTCAGGATTTTAGTAAACCCATCCAGGAAGTGCTCATTGAGAT
GACCGATGGAGGAGTGGACTATTCCTTTGAATGTATTGGTAATGTGAAGGTCATGAGAGCAGCACTTGAG
GCATGTCACAAGGGCTGGGGCGTCAGCGTCGTGGTTGGAGTAGCTGCTTCAGGTGAAGAAATTGCCACTC
GTCCATTCCAGCTGGTAACAGGTCGCACATGGAAAGGCACTGCCTTTGGAGGATGGAAGAGTGTAGAAAG
TGTCCCAAAGTTGGTGTCTGAATATATGTCCAAAAAGATAAAAGTTGATGAATTTGTGACTCACAATCTG
TCTTTTGATGAAATCAACAAAGCCTTTGAACTGATGCATTCTGGAAAGAGCATTCGAACTGTTGTAAAGA
TT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204903 protein sequence
Red=Cloning site Green=Tags(s)

MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVILGHEGA
GIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTSRFTCKGKTILHY
MGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMG
CKVAGASRIIGVDINKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALE
ACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNL
SFDEINKAFELMHSGKSIRTVVKI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000671
ORF Size 1122 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000671.2, NM_000671.3, NM_000671.4, NP_000662.3
RefSeq Size 2652 bp
RefSeq ORF 1125 bp
Locus ID 128
Cytogenetics 4q23
Domains ADH_zinc_N
Protein Families Druggable Genome
Protein Pathways Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Methane metabolism, Retinol metabolism, Tyrosine metabolism
MW 39.7 kDa
Gene Summary This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene. [provided by RefSeq, Oct 2008]

Other Versions

Other products for "ADH5"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ADH5 mouse monoclonal antibody,clone OTI5G4
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools