p15 INK4b (CDKN2B) (NM_004936) Human Tagged ORF Clone
CDKN2B (Myc-DDK-tagged)-Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1
"NM_004936" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CDKN2B |
Synonyms | CDK4I; INK4B; MTS2; P15; p15INK4b; TP15 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204895 representing NM_004936
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCGCGAGGAGAACAAGGGCATGCCCAGTGGGGGCGGCAGCGATGAGGGTCTGGCCAGCGCCGCGGCGC GGGGACTAGTGGAGAAGGTGCGACAGCTCCTGGAAGCCGGCGCGGATCCCAACGGAGTCAACCGTTTCGG GAGGCGCGCGATCCAGGTCATGATGATGGGCAGCGCCCGCGTGGCGGAGCTGCTGCTGCTCCACGGCGCG GAGCCCAACTGCGCAGACCCTGCCACTCTCACCCGACCGGTGCATGATGCTGCCCGGGAGGGCTTCCTGG ACACGCTGGTGGTGCTGCACCGGGCCGGGGCGCGGCTGGACGTGCGCGATGCCTGGGGTCGTCTGCCCGT GGACTTGGCCGAGGAGCGGGGCCACCGCGACGTTGCAGGGTACCTGCGCACAGCCACGGGGGAC AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGATAAGGTTTAA >RC204895 representing NM_004936
Red=Cloning site Green=Tags(s) MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-RsrI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_004936 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_004936.4 |
RefSeq Size | 3878 bp |
RefSeq ORF | 417 bp |
Locus ID | 1030 |
UniProt ID | P42772 |
Cytogenetics | 9p21.3 |
Domains | ANK |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway |
MW | 14.5 kDa |
Gene Summary | This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
cDNA Clone Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204895L1 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, Myc-DDK-tagged |
USD 768.00 |
|
RC204895L2 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mGFP tagged |
USD 768.00 |
|
RC204895L3 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, Myc-DDK-tagged |
USD 768.00 |
|
RC204895L4 | Lenti ORF clone of Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1, mGFP tagged |
USD 768.00 |
|
RG204895 | CDKN2B (GFP-tagged) - Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1 |
USD 517.00 |
|
SC319536 | CDKN2B (untagged)-Human cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) (CDKN2B), transcript variant 1 |
USD 429.00 |
USD 165.00
USD 627.00
USD 417.00
USD 149.00
USD 55.00