CDX2 (NM_001265) Human Tagged ORF Clone

CAT#: RC204883

Reviews ()
Write a review

CDX2 (Myc-DDK-tagged)-Human caudal type homeobox 2 (CDX2)



Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "CDX2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CDX2
Synonyms CDX-3; CDX2/AS; CDX3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204883 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACGTGAGCTACCTCCTGGACAAGGACGTGAGCATGTACCCTAGCTCCGTGCGCCACTCTGGCGGCC
TCAACCTGGCGCCGCAGAACTTCGTCAGCCCCCCGCAGTACCCGGACTACGGCGGTTACCACGTGGCGGC
CGCAGCTGCAGCGGCAGCGAACTTGGACAGCGCGCAGTCCCCGGGGCCATCCTGGCCGGCAGCGTATGGC
GCCCCACTCCGGGAGGACTGGAATGGCTACGCGCCCGGAGGCGCCGCGGCCGCCGCCAACGCCGTGGCTC
ACGGCCTCAACGGTGGCTCCCCGGCCGCAGCCATGGGCTACAGCAGCCCCGCAGACTACCATCCGCACCA
CCACCCGCATCACCACCCGCACCACCCGGCCGCCGCGCCTTCCTGCGCTTCTGGGCTGCTGCAAACGCTC
AACCCCGGCCCTCCTGGGCCCGCCGCCACCGCTGCCGCCGAGCAGCTGTCTCCCGGCGGCCAGCGGCGGA
ACCTGTGCGAGTGGATGCGGAAGCCGGCGCAGCAGTCCCTCGGCAGCCAAGTGAAAACCAGGACGAAAGA
CAAATATCGAGTGGTGTACACGGACCACCAGCGGCTGGAGCTGGAGAAGGAGTTTCACTACAGTCGCTAC
ATCACCATCCGGAGGAAAGCCGAGCTAGCCGCCACGCTGGGGCTCTCTGAGAGGCAGGTTAAAATCTGGT
TTCAGAACCGCAGAGCAAAGGAGAGGAAAATCAACAAGAAGAAGTTGCAGCAGCAACAGCAGCAGCAGCC
ACCACAGCCGCCTCCGCCGCCACCACAGCCTCCCCAGCCTCAGCCAGGTCCTCTGAGAAGTGTCCCAGAG
CCCTTGAGTCCGGTGTCTTCCCTGCAAGCCTCAGTGTCTGGCTCTGTCCCTGGGGTTCTGGGGCCAACTG
GGGGGGTGCTAAACCCCACCGTCACCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204883 protein sequence
Red=Cloning site Green=Tags(s)

MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYG
APLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTL
NPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY
ITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE
PLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001265
ORF Size 939 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001265.5
RefSeq Size 2370 bp
RefSeq ORF 942 bp
Locus ID 1045
UniProt ID Q99626
Cytogenetics 13q12.2
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors
MW 33.5 kDa
Gene Summary This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis. [provided by RefSeq, Jan 2012]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.