DHX58 (NM_024119) Human Tagged ORF Clone

CAT#: RC204837

DHX58 (Myc-DDK-tagged)-Human DEXH (Asp-Glu-X-His) box polypeptide 58 (DHX58)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DHX58 (NM_024119) Human Tagged ORF Clone
Symbol DHX58
Synonyms D11LGP2; D11lgp2e; LGP2; RLR-3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204837 representing NM_024119
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTTCGGTCCTACCAATGGGAGGTGATCATGCCTGCCCTGGAGGGCAAGAATATCATCATCTGGC
TGCCCACGGGTGCCGGGAAGACCCGGGCGGCTGCTTATGTGGCCAAGCGGCACCTAGAGACTGTGGATGG
AGCCAAGGTGGTTGTATTGGTCAACAGGGTGCACCTGGTGACCCAGCATGGTGAAGAGTTCAGGCGCATG
CTGGATGGACGCTGGACCGTGACAACCCTGAGTGGGGACATGGGACCACGTGCTGGCTTTGGCCACCTGG
CCCGGTGCCATGACCTGCTCATCTGCACAGCAGAGCTTCTGCAGATGGCACTGACCAGCCCCGAGGAGGA
GGAGCACGTGGAGCTCACTGTCTTCTCCCTGATCGTGGTGGATGAGTGCCACCACACGCACAAGGACACC
GTCTACAACGTCATCATGAGCCAGTACCTAGAACTTAAACTCCAGAGGGCACAGCCGCTACCCCAGGTGC
TGGGTCTCACAGCCTCCCCAGGCACTGGCGGGGCCTCCAAACTCGATGGGGCCATCAACCACGTCCTGCA
GCTCTGTGCCAACTTGGACACGTGGTGCATCATGTCACCCCAGAACTGCTGCCCCCAGCTGCAGGAGCAC
AGCCAACAGCCTTGCAAACAGTACAACCTCTGCCACAGGCGCAGCCAGGATCCGTTTGGGGACTTGCTGA
AGAAGCTCATGGACCAAATCCATGACCACCTGGAGATGCCTGAGTTGAGCCGGAAATTTGGGACGCAAAT
GTATGAGCAGCAGGTGGTGAAGCTGAGTGAGGCTGCGGCTTTGGCTGGGCTTCAGGAGCAACGGGTGTAT
GCGCTTCACCTGAGGCGCTACAATGACGCGCTGCTCATCCATGACACCGTCCGCGCCGTGGATGCCTTGG
CTGCGCTGCAGGATTTCTATCACAGGGAGCACGTCACTAAAACCCAGATCCTGTGTGCCGAGCGCCGGCT
GCTGGCCCTGTTCGATGACCGCAAGAATGAGCTGGCCCACTTGGCAACTCATGGCCCAGAGAATCCAAAA
CTGGAGATGCTGGAAAAGATCCTGCAAAGGCAGTTCAGTAGCTCTAACAGCCCTCGGGGTATCATCTTCA
CCCGCACCCGCCAAAGCGCACACTCCCTCCTGCTCTGGCTCCAGCAGCAGCAGGGCCTGCAGACTGTGGA
CATCCGGGCCCAGCTACTGATTGGGGCTGGGAACAGCAGCCAGAGCACCCACATGACCCAGAGGGACCAG
CAAGAAGTGATCCAGAAGTTCCAAGATGGAACCCTGAACCTTCTGGTGGCCACGAGTGTGGCGGAGGAGG
GGCTGGACATCCCACATTGCAATGTGGTGGTGCGTTATGGGCTCTTGACCAATGAAATCTCCATGGTCCA
GGCCAGGGGCCGTGCCCGGGCCGATCAGAGTGTATACGCGTTTGTAGCAACTGAAGGTAGCCGGGAGCTG
AAGCGGGAGCTGATCAACGAGGCGCTGGAGACGCTGATGGAGCAGGCAGTGGCTGCTGTGCAGAAAATGG
ACCAGGCCGAGTACCAGGCCAAGATCCGGGATCTGCAGCAGGCAGCCTTGACCAAGCGGGCGGCCCAGGC
AGCCCAGCGGGAGAACCAGCGGCAGCAGTTCCCAGTGGAGCACGTGCAGCTACTCTGCATCAACTGCATG
GTGGCTGTGGGCCATGGCAGCGACCTGCGGAAGGTGGAGGGCACCCACCATGTCAATGTGAACCCCAACT
TCTCGAACTACTATAATGTCTCCAGGGATCCTGTGGTCATCAACAAAGTCTTCAAGGACTGGAAGCCTGG
GGGTGTCATCAGCTGCAGGAACTGTGGGGAGGTCTGGGGTCTGCAGATGATCTACAAGTCAGTGAAGCTG
CCAGTGCTCAAAGTCCGCAGCATGCTGCTGGAGACCCCTCAGGGGCGGATCCAGGCCAAAAAGTGGTCCC
GCGTGCCCTTCTCCGTGCCTGACTTTGACTTCCTGCAGCATTGTGCCGAGAACTTGTCGGACCTCTCCCT
GGAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204837 representing NM_024119
Red=Cloning site Green=Tags(s)

MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRM
LDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDT
VYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEH
SQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVY
ALHLRRYNDALLIHDTVRAVDALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPK
LEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSREL
KRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCM
VAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKL
PVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024119
ORF Size 2034 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024119.1, NM_024119.2, NP_077024
RefSeq Size 2613
RefSeq ORF 2037
Locus ID 79132
Cytogenetics 17q21.2
Protein Pathways RIG-I-like receptor signaling pathway
MW 76.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations