Hex (HHEX) (NM_002729) Human Tagged ORF Clone

CAT#: RC204815

Reviews ()
Write a review

HHEX (Myc-DDK-tagged)-Human hematopoietically expressed homeobox (HHEX)



  "NM_002729" in other vectors (6)

Reconstitution Protocol

USD 300.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "HHEX"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HHEX
Synonyms HEX; HMPH; HOX11L-PEN; PRH; PRHX
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204815 representing NM_002729
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTACCCGCACCCCGGGCCGGCGGCGGGCGCCGTGGGGGTGCCGCTGTACGCGCCCACGCCGCTGC
TGCAACCCGCACACCCGACGCCCTTTTACATCGAGGACATCCTGGGCCGCGGGCCCGCCGCGCCCACGCC
CGCCCCCACGCTGCCGTCCCCCAACTCCTCCTTCACCAGCCTCGTGTCCCCCTACCGGACCCCGGTGTAC
GAGCCCACGCCGATCCATCCAGCCTTCTCGCACCACTCCGCCGCCGCGCTGGCCGCTGCCTACGGACCCG
GCGGCTTCGGGGGCCCTCTGTACCCCTTCCCGCGGACGGTGAACGACTACACGCACGCCCTGCTCCGCCA
CGACCCCCTGGGCAAACCTCTACTCTGGAGCCCCTTCTTGCAGAGGCCTCTGCATAAAAGGAAAGGCGGC
CAGGTGAGATTCTCCAACGACCAGACCATCGAGCTGGAGAAGAAATTCGAGACGCAGAAATATCTCTCTC
CGCCCGAGAGGAAGCGTCTGGCCAAGATGCTGCAGCTCAGCGAGAGACAGGTCAAAACCTGGTTTCAGAA
TCGACGCGCTAAATGGAGGAGACTAAAACAGGAGAACCCTCAAAGCAATAAAAAAGAAGAACTGGAAAGT
TTGGACAGTTCCTGTGATCAGAGGCAAGATTTGCCCAGTGAACAGAATAAAGGTGCTTCTTTGGATAGCT
CTCAATGTTCGCCCTCCCCTGCCTCCCAGGAAGACCTTGAATCAGAGATTTCAGAGGATTCTGATCAGGA
AGTGGACATTGAGGGCGATAAAAGCTATTTTAATGCTGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204815 representing NM_002729
Red=Cloning site Green=Tags(s)

MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY
EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG
QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES
LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002729
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002729.5
RefSeq Size 1772 bp
RefSeq ORF 813 bp
Locus ID 3087
UniProt ID Q03014
Cytogenetics 10q23.33
Domains homeobox
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
MW 29.8 kDa
Gene Summary This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.