Hex(HHEX) (NM_002729) Human Tagged ORF Clone

CAT#: RC204815

HHEX (Myc-DDK-tagged)-Human hematopoietically expressed homeobox (HHEX)

Clone Modification / Custom Cloning Service

USD 485.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Hex(HHEX) (NM_002729) Human Tagged ORF Clone
Symbol HHEX
Synonyms HEX; HMPH; HOX11L-PEN; PRH; PRHX
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204815 representing NM_002729
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTACCCGCACCCCGGGCCGGCGGCGGGCGCCGTGGGGGTGCCGCTGTACGCGCCCACGCCGCTGC
TGCAACCCGCACACCCGACGCCCTTTTACATCGAGGACATCCTGGGCCGCGGGCCCGCCGCGCCCACGCC
CGCCCCCACGCTGCCGTCCCCCAACTCCTCCTTCACCAGCCTCGTGTCCCCCTACCGGACCCCGGTGTAC
GAGCCCACGCCGATCCATCCAGCCTTCTCGCACCACTCCGCCGCCGCGCTGGCCGCTGCCTACGGACCCG
GCGGCTTCGGGGGCCCTCTGTACCCCTTCCCGCGGACGGTGAACGACTACACGCACGCCCTGCTCCGCCA
CGACCCCCTGGGCAAACCTCTACTCTGGAGCCCCTTCTTGCAGAGGCCTCTGCATAAAAGGAAAGGCGGC
CAGGTGAGATTCTCCAACGACCAGACCATCGAGCTGGAGAAGAAATTCGAGACGCAGAAATATCTCTCTC
CGCCCGAGAGGAAGCGTCTGGCCAAGATGCTGCAGCTCAGCGAGAGACAGGTCAAAACCTGGTTTCAGAA
TCGACGCGCTAAATGGAGGAGACTAAAACAGGAGAACCCTCAAAGCAATAAAAAAGAAGAACTGGAAAGT
TTGGACAGTTCCTGTGATCAGAGGCAAGATTTGCCCAGTGAACAGAATAAAGGTGCTTCTTTGGATAGCT
CTCAATGTTCGCCCTCCCCTGCCTCCCAGGAAGACCTTGAATCAGAGATTTCAGAGGATTCTGATCAGGA
AGTGGACATTGAGGGCGATAAAAGCTATTTTAATGCTGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204815 representing NM_002729
Red=Cloning site Green=Tags(s)

MQYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVY
EPTPIHPAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG
QVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELES
LDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002729
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002729.1, NM_002729.2, NM_002729.3, NM_002729.4, NP_002720
RefSeq Size 1772
RefSeq ORF 813
Locus ID 3087
Cytogenetics 10q23.33
Domains homeobox
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Maturity onset diabetes of the young
MW 29.8 kDa
Gene Summary This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)