CHMP4C (NM_152284) Human Tagged ORF Clone

CAT#: RC204802

Reviews ()
Write a review

CHMP4C (Myc-DDK-tagged)-Human chromatin modifying protein 4C (CHMP4C)



  "NM_152284" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 300.00

USD 450.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CHMP4C"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CHMP4C
Synonyms Shax3; SNF7-3; VPS32C
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204802 representing NM_152284
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAAGTTGGGCAAGTTCTTTAAAGGGGGCGGCTCTTCTAAGAGCCGAGCCGCTCCCAGTCCCCAGG
AGGCCCTGGTCCGACTTCGGGAGACTGAGGAGATGCTGGGCAAGAAACAAGAGTACCTGGAAAATCGAAT
CCAGAGAGAAATCGCCCTGGCCAAGAAGCACGGCACGCAGAATAAGCGAGCTGCATTACAGGCACTAAAG
AGAAAGAAGAGGTTCGAGAAACAGCTCACTCAGATTGATGGCACACTTTCTACCATTGAGTTCCAGAGAG
AAGCCCTGGAGAACTCACACACCAACACTGAGGTGTTGAGGAACATGGGCTTTGCAGCAAAAGCGATGAA
ATCTGTTCATGAAAACATGGATCTGAACAAAATAGATGATTTGATGCAAGAGATCACAGAGCAACAGGAT
ATCGCCCAAGAAATCTCAGAAGCATTTTCTCAACGGGTTGGCTTTGGTGATGACTTTGATGAGGATGAGT
TGATGGCAGAACTTGAAGAATTGGAACAGGAGGAATTAAATAAGAAGATGACAAATATCCGCCTTCCAAA
TGTGCCTTCCTCTTCTCTCCCAGCACAGCCAAATAGAAAACCAGGCATGTCGTCCACTGCACGTCGATCC
CGAGCAGCATCTTCCCAGAGGGCAGAAGAAGAGGATGATGATATCAAACAATTGGCAGCTTGGGCTACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204802 representing NM_152284
Red=Cloning site Green=Tags(s)

MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS
RAASSQRAEEEDDDIKQLAAWAT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_152284
ORF Size 699 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_152284.4
RefSeq Size 1847 bp
RefSeq ORF 702 bp
Locus ID 92421
UniProt ID Q96CF2
Cytogenetics 8q21.13
Protein Pathways Endocytosis
MW 26.2 kDa
Gene Summary CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.