PNPLA4 (NM_004650) Human Tagged ORF Clone

CAT#: RC204732

PNPLA4 (Myc-DDK-tagged)-Human patatin-like phospholipase domain containing 4 (PNPLA4), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_004650" in other vectors (5)

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-PNPLA4 Antibody
    • 100 ul

USD 539.00

Other products for "PNPLA4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PNPLA4
Synonyms DXS1283E; GS2; iPLA2eta
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204732 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCACATCAACCTATCATTTGCAGCGTGTGGATTTCTGGGCATTTACCACTTGGGGGCAGCATCTG
CACTTTGCAGACATGGCAAAAAACTTGTGAAGGATGTCAAAGCCTTCGCTGGGGCGTCTGCGGGATCGTT
GGGTGCTTCTGTTCTGCTAACAGCACCAGAAAAAATAGAGGAATGTAACCAATTTACCTACAAGTTTGCC
GAAGAAATCAGAAGGCAGTCTTTCGGGGCAGTAACGCCCGGTTATGACTTCATGGCCCGACTAAGAAGTG
GGATGGAGTCGATTCTTCCTCCCAGCGCTCACGAGCTGGCCCAGAACCGACTGCACGTATCCATCACCAA
CGCCAAAACCAGAGAAAATCACTTAGTCTCCACTTTTTCCTCCAGGGAGGGCCTCATTAAGGTCCTCCTA
GCCAGCAGTTTTGTGCCCATTTATGCAGGACTGAAGCTAGTGGAATACAAAGGGCAGAAGTGGGTGGACG
GAGGCCTCACCAACGCTCTTCCCATCCTGCCCGTCGGCCGGACAGTAACCATCTCCCCCTTCAGTGGACG
ACTGGACATCTCCCCGCAGGACAAAGGGCAGCTAGATCTGTATGTTAATATCGCCAAGCAGGATATCATG
TTGTCCCTGGCAAACCTGGTGAGACTCAACCAAGCCCTTTTTCCCCCAAGCAAGAGGAAAATGGAATCTT
TGTATCAGTGTGGTTTTGATGACACTGTTAAGTTTTTACTTAAAGAAAATTGGTTTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204732 protein sequence
Red=Cloning site Green=Tags(s)

MKHINLSFAACGFLGIYHLGAASALCRHGKKLVKDVKAFAGASAGSLGASVLLTAPEKIEECNQFTYKFA
EEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREGLIKVLL
ASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLDLYVNIAKQDIM
LSLANLVRLNQALFPPSKRKMESLYQCGFDDTVKFLLKENWFE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004650
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004650.3
RefSeq Size 2847 bp
RefSeq ORF 762 bp
Locus ID 8228
UniProt ID P41247
Cytogenetics Xp22.31
Protein Pathways Retinol metabolism
MW 27.9 kDa
Gene Summary This gene encodes a member of the patatin-like family of phospholipases. The encoded enzyme has both triacylglycerol lipase and transacylase activities and may be involved in adipocyte triglyceride homeostasis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome Y. [provided by RefSeq, Feb 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.