CLIC2 (NM_001289) Human Tagged ORF Clone

CAT#: RC204727

Reviews ()
Write a review

CLIC2 (Myc-DDK-tagged)-Human chloride intracellular channel 2 (CLIC2)



  "NM_001289" in other vectors (7)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name CLIC2 (NM_001289) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CLIC2
Synonyms CLCNL2; CLIC2b; MRXS32; XAP121
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204727 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGGCCTGCGGCCCGGCACTCAAGTGGACCCTGAGATTGAGCTTTTTGTAAAGGCTGGAAGTGATG
GAGAGAGTATTGGAAACTGTCCCTTTTGCCAACGCCTTTTCATGATCCTCTGGCTTAAAGGAGTTAAATT
TAATGTGACAACTGTTGACATGACCAGAAAGCCTGAAGAACTAAAGGACTTAGCCCCAGGTACCAATCCT
CCGTTCCTGGTGTATAACAAGGAGTTGAAAACAGACTTCATTAAAATTGAGGAGTTTTTAGAACAAACCC
TGGCTCCTCCAAGGTACCCTCACCTGAGTCCCAAGTACAAGGAGTCTTTTGATGTGGGCTGTAACCTCTT
TGCCAAGTTTTCTGCATACATTAAGAATACACAAAAGGAGGCAAATAAGAATTTTGAAAAATCTCTGCTC
AAAGAATTCAAGCGTCTGGATGACTACTTAAACACCCCACTTCTGGATGAAATTGATCCAGACAGTGCTG
AGGAACCCCCAGTTTCCAGAAGACTATTCTTGGATGGGGACCAGCTAACACTGGCTGATTGTAGCTTGTT
ACCCAAGCTGAACATTATTAAAGTTGCTGCCAAGAAATATCGTGACTTTGACATTCCAGCAGAATTCTCA
GGAGTCTGGCGTTATCTCCACAATGCCTATGCCCGTGAAGAATTTACCCACACGTGTCCTGAAGACAAAG
AAATTGAAAATACTTACGCAAATGTGGCTAAACAGAAGAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204727 protein sequence
Red=Cloning site Green=Tags(s)

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP
PFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLL
KEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFS
GVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001289
ORF Size 741 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001289.6
RefSeq Size 2694 bp
RefSeq ORF 744 bp
Locus ID 1193
UniProt ID O15247
Cytogenetics Xq28
Protein Families Druggable Genome, Ion Channels: Other
MW 28.4 kDa
Gene Summary This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017]

Other Versions

Other products for "CLIC2"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-CLIC2 Antibody
    • 100 ul

USD 360.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 135.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools