CYP4B1 (NM_000779) Human Tagged ORF Clone

CAT#: RC204606

CYP4B1 (Myc-DDK-tagged)-Human cytochrome P450, family 4, subfamily B, polypeptide 1 (CYP4B1), transcript variant 2

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CYP4B1 (NM_000779) Human Tagged ORF Clone
Symbol CYP4B1
Synonyms CYPIVB1; P-450HP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204606 representing NM_000779
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGCCCAGCTTCCTCTCCCTGAGCTTCTCCTCCTTGGGCCTGTGGGCTTCTGGGCTGATCTTGGTCT
TAGGCTTTCTCAAGCTCATCCACCTGCTGCTGCGGAGGCAGACGTTGGCTAAGGCTATGGACAAATTCCC
AGGGCCTCCCACCCACTGGCTTTTTGGACATGCCCTCGAGATCCAGGAGACGGGGAGCCTGGACAAAGTG
GTGTCCTGGGCCCACCAGTTCCCGTATGCCCACCCACTCTGGTTCGGACAGTTCATTGGCTTCCTGAACA
TCTATGAGCCTGACTATGCCAAAGCTGTGTACAGCCGTGGGGACCCTAAGGCCCCTGATGTGTATGACTT
CTTCCTCCAGTGGATTGGGAGAGGCCTGCTGGTTCTTGAGGGGCCCAAGTGGTTGCAGCACCGCAAGCTG
CTCACACCTGGCTTTCATTATGATGTGCTGAAGCCCTATGTGGCCGTGTTCACTGAGTCTACACGTATCA
TGCTGGACAAGTGGGAAGAGAAAGCTCGGGAGGGTAAGTCCTTTGACATCTTCTGCGATGTGGGTCACAT
GGCGCTGAACACACTCATGAAGTGCACCTTTGGAAGAGGAGACACCGGCCTGGGCCACAGCAGGGACAGC
AGCTACTACCTTGCAGTCAGCGATCTCACTCTGTTGATGCAGCAGCGCCTTGTGTCCTTCCAGTACCATA
ATGACTTCATCTACTGGCTCACCCCACATGGCCGCCGCTTCCTGCGGGCCTGCCAGGTGGCCCATGACCA
TACAGACCAGGTCATCAGGGAGCGGAAGGCAGCCCTGCAGGATGAGAAGGTGCGGAAGAAGATCCAGAAC
CGGAGGCACCTGGACTTCCTGGACATTCTCCTGGGTGCCCGGGATGAAGATGACATCAAACTGTCAGATG
CAGACCTCCGGGCTGAAGTGGACACATTCATGTTTGAAGGCCATGACACCACCACCAGTGGTATCTCCTG
GTTTCTCTACTGCATGGCCCTGTACCCTGAGCACCAGCATCGTTGTAGAGAGGAGGTCCGCGAGATCCTA
GGGGACCAGGACTTCTTCCAGTGGGATGATCTGGGCAAAATGACTTATCTGACCATGTGCATCAAGGAGA
GCTTCCGCCTCTACCCACCTGTGCCCCAGGTGTACCGCCAGCTCAGCAAGCCTGTCACCTTTGTGGATGG
CCGGTCTCTACCTGCAGGAAGCCTGATCTCTATGCATATCTATGCCCTCCATAGGAACAGTGCTGTATGG
CCCGACCCTGAGGTCTTTGACTCTCTGCGCTTTTCCACTGAGAATGCATCCAAACGCCATCCCTTTGCCT
TTATGCCCTTCTCTGCTGGGCCCAGGAACTGCATTGGGCAGCAGTTTGCCATGAGTGAGATGAAGGTGGT
CACAGCCATGTGCTTGCTCCGCTTTGAGTTCTCTCTGGACCCCTCACGGCTGCCCATCAAGATGCCCCAG
CTTGTCCTGCGCTCCAAGAATGGCTTTCACCTCCACCTGAAGCCACTGGGCCCTGGGTCTGGGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204606 representing NM_000779
Red=Cloning site Green=Tags(s)

MVPSFLSLSFSSLGLWASGLILVLGFLKLIHLLLRRQTLAKAMDKFPGPPTHWLFGHALEIQETGSLDKV
VSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQWIGRGLLVLEGPKWLQHRKL
LTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHSRDS
SYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQN
RRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREIL
GDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVW
PDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQ
LVLRSKNGFHLHLKPLGPGSGK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000779
ORF Size 1536 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000779.1, NM_000779.2, NM_000779.3, NP_000770
RefSeq Size 2147
RefSeq ORF 1536
Locus ID 1580
Cytogenetics 1p33
Domains p450
Protein Families Transmembrane, P450, Druggable Genome
MW 58.8 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. In rodents, the homologous protein has been shown to metabolize certain carcinogens; however, the specific function of the human protein has not been determined. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)