Cytochrome P450 2C8(CYP2C8) (NM_000770) Human Tagged ORF Clone

CAT#: RC204605

CYP2C8 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily C, polypeptide 8 (CYP2C8), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cytochrome P450 2C8(CYP2C8) (NM_000770) Human Tagged ORF Clone
Symbol CYP2C8
Synonyms CPC8; CYPIIC8; MP-12/MP-20
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204605 representing NM_000770
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACCTTTTGTGGTCCTGGTGCTGTGTCTCTCTTTTATGCTTCTCTTTTCACTCTGGAGACAGAGCT
GTAGGAGAAGGAAGCTCCCTCCTGGCCCCACTCCTCTTCCTATTATTGGAAATATGCTACAGATAGATGT
TAAGGACATCTGCAAATCTTTCACCAATTTCTCAAAAGTCTATGGTCCTGTGTTCACCGTGTATTTTGGC
ATGAATCCCATAGTGGTGTTTCATGGATATGAGTCAGTGAAGGAAGCCCTGATTGATAATGGAGAGGAGT
TTTCTGGAAGAGGCAATTCCCCAATATCTCAAAGAATTACTAAAGGACTTGGAATCATTTCCAGCAATGG
AAAGAGATGGAAGGAGATCCGGCGTTTCTCCCTCACAACCTTGCGGAATTTTGGGATGGGGAAGAGGAGC
ATTGAGGACCGTGTTCAAGAGGAAGCTCACTGCCTTGTGGAGGAGTTGAGAAAAACCAAGGCTTCACCCT
GTGATCCCACTTTCATCCTGGGCTGTGCTCCCTGCAATGTGATCTGCTCCGTTGTTTTCCAGAAACGATT
TGATTATAAAGATCAGAATTTTCTCACCCTGATGAAAAGATTCAATGAAAACTTCAGGATTCTGAACTCC
CCATGGATCCAGGTCTGCAATAATTTCCCTCTACTCATTGATTGTTTCCCAGGAACTCACAACAAAGTGC
TTAAAAATGTTGCTCTTACACGAAGTTACATTAGGGAGAAAGTAAAAGAACACCAAGCATCACTGGATGT
TAACAATCCTCGGGACTTTATCGATTGCTTCCTGATCAAAATGGAGCAGGAAAAGGACAACCAAAAGTCA
GAATTCAATATTGAAAACTTGGTTGGCACTGTAGCTGATCTATTTGTTGCTGGAACAGAGACAACAAGCA
CCACTCTGAGATATGGACTCCTGCTCCTGCTGAAGCACCCAGAGGTCACAGCTAAAGTCCAGGAAGAGAT
TGATCATGTAATTGGCAGACACAGGAGCCCCTGCATGCAGGATAGGAGCCACATGCCTTACACTGATGCT
GTAGTGCACGAGATCCAGAGATACAGTGACCTTGTCCCCACCGGTGTGCCCCATGCAGTGACCACTGATA
CTAAGTTCAGAAACTACCTCATCCCCAAGGGCACAACCATAATGGCATTACTGACTTCCGTGCTACATGA
TGACAAAGAATTTCCTAATCCAAATATCTTTGACCCTGGCCACTTTCTAGATAAGAATGGCAACTTTAAG
AAAAGTGACTACTTCATGCCTTTCTCAGCAGGAAAACGAATTTGTGCAGGAGAAGGACTTGCCCGCATGG
AGCTATTTTTATTTCTAACCACAATTTTACAGAACTTTAACCTGAAATCTGTTGATGATTTAAAGAACCT
CAATACTACTGCAGTTACCAAAGGGATTGTTTCTCTGCCACCCTCATACCAGATCTGCTTCATCCCTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204605 representing NM_000770
Red=Cloning site Green=Tags(s)

MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFG
MNPIVVFHGYESVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRS
IEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNS
PWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKS
EFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDA
VVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000770
ORF Size 1470 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000770.1, NM_000770.2, NM_000770.3, NP_000761
RefSeq Size 1924
RefSeq ORF 1473
Locus ID 1558
Cytogenetics 10q23.33
Domains p450
Protein Families Transmembrane, P450, Druggable Genome
Protein Pathways Arachidonic acid metabolism, Linoleic acid metabolism, Retinol metabolism, Metabolism of xenobiotics by cytochrome P450, Drug metabolism - cytochrome P450, Metabolic pathways
MW 55.6 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, benzo(a)pyrene, 7-ethyoxycoumarin, and the anti-cancer drug taxol. This gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Nov 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations