RPP14 (NM_007042) Human Tagged ORF Clone

CAT#: RC204469

RPP14 (Myc-DDK-tagged)-Human ribonuclease P/MRP 14kDa subunit (RPP14), transcript variant 2

  View "NM_007042" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name RPP14 (NM_007042) Human Tagged ORF Clone
Symbol RPP14
Synonyms HsHTD2; P14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204469 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGCCCCTGCTGCCACATATGAAAGAGTAGTTTACAAAAACCCTTCCGAGTACCACTACATGAAAG
TCTGCCTAGAATTTCAAGATTGTGGAGTTGGACTGAATGCTGCACAGTTCAAACAGCTGCTTATTTCGGC
TGTGAAGGACCTGTTTGGGGAGGTTGATGCCGCCTTACCTTTGGACATCCTAACCTATGAAGAGAAGACC
TTGTCAGCCATCTTGAGAATATGTAGCAGTGGTCTTGTCAAATTGTGGAGCTCTTTGACCCTGTTAGGAT
CCTATAAAGGCAAAAAATGTGCTTTCCGGGTGATTCAGGTTTCTCCATTTCTTCTTGCATTATCTGGTAA
TAGTAGGGAACTAGTATTGGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204469 protein sequence
Red=Cloning site Green=Tags(s)

MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKT
LSAILRICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007042
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007042.1, NM_007042.2, NM_007042.3, NM_007042.4, NP_008973
RefSeq Size 3266
RefSeq ORF 375
Locus ID 11102
Cytogenetics 3p14.3
Domains MaoC_dehydratas
MW 13.7 kDa
Gene Summary This gene encodes a subunit of ribonuclease P and has 3' to 5' exoribonuclease activity. Transcripts for this gene are bicistronic and include a conserved downstream open reading frame for the hydroxyacyl-thioester dehydratase type 2 (HTD2) gene. [provided by RefSeq, May 2017]

Other Versions

Other products for "RPP14"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones