GNS (NM_002076) Human Tagged ORF Clone

CAT#: RC204458

Reviews ()
Write a review

GNS (Myc-DDK-tagged)-Human glucosamine (N-acetyl)-6-sulfatase (GNS)



  "NM_002076" in other vectors (4)

USD 494.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GNS (NM_002076) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GNS
Synonyms G6S
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204458 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCTCCTGCCTCTAGCCCCAGGTCGGCTCCGGCGGGGCAGCCCCCGCCACCTGCCCTCCTGCAGCC
CAGCGCTGCTACTGCTGGTGCTGGGCGGCTGCCTGGGGGTCTTCGGGGTGGCTGCGGGAACCCGGAGGCC
CAACGTGGTGCTGCTCCTCACGGACGACCAGGACGAAGTGCTCGGCGGCATGACACCGCTAAAGAAAACC
AAAGCTCTCATCGGAGAGATGGGGATGACTTTTTCCAGTGCTTATGTGCCAAGTGCTCTCTGCTGCCCCA
GCAGAGCCAGTATCCTGACAGGAAAGTACCCACATAATCATCACGTTGTGAACAACACTCTGGAGGGGAA
CTGCAGTAGTAAGTCCTGGCAGAAGATCCAAGAACCAAATACTTTCCCAGCAATTCTCAGATCAATGTGT
GGTTATCAGACCTTTTTTGCAGGGAAATATTTAAATGAGTACGGAGCCCCAGATGCAGGTGGACTAGAAC
ACGTTCCTCTGGGTTGGAGTTACTGGTATGCCTTGGAAAAGAATTCTAAGTATTATAATTACACCCTGTC
TATCAATGGGAAGGCACGGAAGCATGGTGAAAACTATAGTGTGGACTACCTGACAGATGTTTTGGCTAAT
GTCTCCTTGGACTTTCTGGACTACAAGTCCAACTTTGAGCCCTTCTTCATGATGATCGCCACTCCAGCGC
CTCATTCGCCTTGGACAGCTGCACCTCAGTACCAGAAGGCTTTCCAGAATGTCTTTGCACCAAGAAACAA
GAACTTCAACATCCATGGAACGAACAAGCACTGGTTAATTAGGCAAGCCAAGACTCCAATGACTAATTCT
TCAATACAGTTTTTAGATAATGCATTTAGGAAAAGGTGGCAAACTCTCCTCTCAGTTGATGACCTTGTGG
AGAAACTGGTCAAGAGGCTGGAGTTCACTGGGGAGCTCAACAACACTTACATCTTCTATACCTCAGACAA
TGGCTATCACACAGGACAGTTTTCCTTGCCAATAGACAAGAGACAGCTGTATGAGTTTGATATCAAAGTT
CCACTGTTGGTTCGAGGACCTGGGATCAAACCAAATCAGACAAGCAAGATGCTGGTTGCCAACATTGACT
TGGGTCCTACTATTTTGGACATTGCTGGCTACGACCTAAATAAGACACAGATGGATGGGATGTCCTTATT
GCCCATTTTGAGAGGTGCCAGTAACTTGACCTGGCGATCAGATGTCCTGGTGGAATACCAAGGAGAAGGC
CGTAACGTCACTGACCCAACATGCCCTTCCCTGAGTCCTGGCGTATCTCAATGCTTCCCAGACTGTGTAT
GTGAAGATGCTTATAACAATACCTATGCCTGTGTGAGGACAATGTCAGCATTGTGGAATTTGCAGTATTG
CGAGTTTGATGACCAGGAGGTGTTTGTAGAAGTCTATAATCTGACTGCAGACCCAGACCAGATCACTAAC
ATTGCTAAAACCATAGACCCAGAGCTTTTAGGAAAGATGAACTATCGGTTAATGATGTTACAGTCCTGTT
CTGGGCCAACCTGTCGCACTCCAGGGGTTTTTGACCCCGGATACAGGTTTGACCCCCGTCTCATGTTCAG
CAATCGCGGCAGTGTCAGGACTCGAAGATTTTCCAAACATCTTCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204458 protein sequence
Red=Cloning site Green=Tags(s)

MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKT
KALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMC
GYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLAN
VSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNS
SIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKV
PLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEG
RNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITN
IAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002076
ORF Size 1656 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002076.4
RefSeq Size 5144 bp
RefSeq ORF 1659 bp
Locus ID 2799
Cytogenetics 12q14.3
Domains Sulfatase
Protein Families Druggable Genome, Transmembrane
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
MW 62.1 kDa
Gene Summary The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools