Rad9 (RAD9A) (NM_004584) Human Tagged ORF Clone

CAT#: RC204439

Reviews ()
Write a review

RAD9A (Myc-DDK-tagged)-Human RAD9 homolog A (S. pombe) (RAD9A)



  "NM_004584" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "RAD9A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAD9A
Synonyms RAD9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204439 representing NM_004584.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAAGTGCCTGGTCACGGGCGGCAACGTGAAGGTGCTCGGCAAGGCCGTCCACTCCCTGTCCCGCATC
GGGGACGAGCTCTACCTGGAACCCTTGGAGGACGGGCTCTCCCTCCGGACGGTGAACTCCTCCCGCTCT
GCCTATGCCTGCTTTCTCTTTGCCCCGCTCTTCTTCCAGCAATACCAGGCAGCCACCCCTGGTCAGGAC
CTGCTGCGCTGTAAGATCCTGATGAAGTCTTTCCTGTCTGTCTTCCGCTCACTGGCGATGCTGGAGAAG
ACGGTGGAAAAATGCTGCATCTCCCTGAATGGCCGGAGCAGCCGCCTGGTGGTCCAGCTGCATTGCAAG
TTCGGGGTGCGGAAGACTCACAACCTGTCCTTCCAGGACTGTGAGTCCCTGCAGGCCGTCTTCGACCCA
GCCTCGTGCCCCCACATGCTCCGCGCCCCAGCACGGGTTCTGGGGGAGGCTGTTCTGCCCTTCTCTCCT
GCACTGGCTGAAGTGACGCTGGGCATTGGCCGTGGCCGCAGGGTCATCCTGCGCAGCTACCACGAGGAG
GAGGCAGACAGCACTGCCAAAGCCATGGTGACTGAGATGTGCCTTGGAGAGGAGGATTTCCAGCAGCTG
CAGGCCCAGGAAGGGGTGGCCATCACTTTCTGCCTCAAGGAATTCCGGGGGCTCCTGAGCTTTGCAGAG
TCAGCAAACTTGAATCTTAGCATTCATTTTGATGCTCCAGGCAGGCCCGCCATCTTCACCATCAAGGAC
TCTTTGCTGGACGGCCACTTTGTCTTGGCCACACTCTCAGACACCGACTCGCACTCCCAGGACCTGGGC
TCCCCAGAGCGTCACCAGCCAGTGCCTCAGCTCCAGGCTCACAGCACACCCCACCCGGACGACTTTGCC
AATGACGACATTGACTCTTACATGATCGCCATGGAAACCACTATAGGCAATGAGGGCTCGCGGGTGCTG
CCCTCCATTTCCCTTTCACCTGGCCCCCAGCCCCCCAAGAGCCCCGGTCCCCACTCCGAGGAGGAAGAT
GAGGCTGAGCCCAGTACAGTGCCTGGGACTCCCCCACCCAAGAAGTTCCGCTCACTGTTCTTCGGCTCC
ATCCTGGCCCCTGTACGCTCCCCCCAGGGCCCCAGCCCTGTGCTGGCGGAAGACAGTGAGGGTGAAGGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC204439
Blue=ORF Red=Cloning site Green=Tag(s)

MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQAATPGQD
LLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDP
ASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEEADSTAKAMVTEMCLGEEDFQQL
QAQEGVAITFCLKEFRGLLSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLG
SPERHQPVPQLQAHSTPHPDDFANDDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEED
EAEPSTVPGTPPPKKFRSLFFGSILAPVRSPQGPSPVLAEDSEGEG

myc-FLAG tag

Recombinant protein using RC204439 also available, TP304439
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004584
ORF Size 1173 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004584.3
RefSeq Size 2128 bp
RefSeq ORF 1176 bp
Locus ID 5883
UniProt ID Q99638
Cytogenetics 11q13.2
Domains Rad9
Protein Families Druggable Genome, Stem cell - Pluripotency
MW 42.5 kDa
Gene Summary This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair. This protein possesses 3' to 5' exonuclease activity, which may contribute to its role in sensing and repairing DNA damage. It forms a checkpoint protein complex with RAD1 and HUS1. This complex is recruited by checkpoint protein RAD17 to the sites of DNA damage, which is thought to be important for triggering the checkpoint-signaling cascade. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.