ACSF2 (NM_025149) Human Tagged ORF Clone

CAT#: RC204368

Reviews ()
Write a review

ACSF2 (Myc-DDK-tagged)-Human acyl-CoA synthetase family member 2 (ACSF2)



  "NM_025149" in other vectors (7)

USD 480.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ACSF2 (NM_025149) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ACSF2
Synonyms ACSMW; AVYV493
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204368 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTCTACGTCGGGATGCTGCGCCTGGGGAGGCTGTGCGCCGGGAGCTCGGGGGTGCTGGGGGCCC
GGGCCGCCCTCTCTCGGAGTTGGCAGGAAGCCAGGTTGCAGGGTGTCCGCTTCCTCAGTTCCAGAGAGGT
GGATCGCATGGTCTCCACGCCCATCGGAGGCCTCAGCTACGTTCAGGGGTGCACCAAAAAGCATCTTAAC
AGCAAGACTGTGGTCCAGTGCCTGGAGACCACAGCACAGAGGGTCCCAGAACGAGAGGCCTTGGTCGTCC
TCCATGAAGACGTCAGGTTGACCTTTGCCCAACTCAAGGAGGAGGTGGACAAAGCTGCTTCTGGCCTCCT
GAGCATTGGCCTCTGCAAAGGTGACCGGCTGGGCATGTGGGGACCTAACTCCTATGCATGGGTGCTCATG
CAGTTGGCCACCGCCCAGGCGGGCATCATTCTGGTGTCTGTGAACCCAGCCTACCAGGCTATGGAACTGG
AGTATGTCCTCAAGAAGGTGGGCTGCAAGGCCCTTGTGTTCCCCAAGCAATTCAAGACCCAGCAATACTA
CAACGTCCTGAAGCAGATCTGTCCAGAAGTGGAGAATGCCCAGCCAGGGGCCTTGAAGAGTCAGAGGCTC
CCAGATCTGACCACAGTCATCTCGGTGGATGCCCCTTTGCCGGGGACCCTGCTCCTGGATGAAGTGGTGG
CGGCTGGCAGCACACGGCAGCATCTGGACCAGCTCCAATACAACCAGCAGTTCCTGTCCTGCCATGACCC
CATCAACATCCAGTTCACCTCGGGGACAACAGGCAGCCCCAAGGGGGCCACCCTCTCCCACTACAACATT
GTCAACAACTCCAACATTTTAGGAGAGCGCCTGAAACTGCATGAGAAGACACCAGAGCAGTTGCGGATGA
TCCTGCCCAACCCCCTGTACCATTGCCTGGGTTCCGTGGCAGGCACAATGATGTGTCTGATGTACGGTGC
CACCCTCATCCTGGCCTCTCCCATCTTCAATGGCAAGAAGGCACTGGAGGCCATCAGCAGAGAGAGAGGC
ACCTTCCTGTATGGTACCCCCACGATGTTCGTGGACATTCTGAACCAGCCAGACTTCTCCAGTTATGACA
TCTCGACCATGTGTGGAGGTGTCATTGCTGGGTCCCCTGCACCTCCAGAGTTGATCCGAGCCATCATCAA
CAAGATAAATATGAAGGACCTGGTGGTTGCTTATGGAACCACAGAGAACAGTCCCGTGACATTCGCGCAC
TTCCCTGAGGACACTGTGGAGCAGAAGGCAGAAAGCGTGGGCAGAATTATGCCTCACACGGAGGCGCGGA
TCATGAACATGGAGGCAGGGACGCTGGCAAAGCTGAACACGCCCGGGGAGCTGTGCATCCGAGGGTACTG
CGTCATGCTGGGCTACTGGGGTGAGCCTCAGAAGACAGAGGAAGCAGTGGATCAGGACAAGTGGTATTGG
ACAGGAGATGTCGCCACAATGAATGAGCAGGGCTTCTGCAAGATCGTGGGCCGCTCTAAGGATATGATCA
TCCGGGGTGGTGAGAACATCTACCCCGCAGAGCTCGAGGACTTCTTTCACACACACCCGAAGGTGCAGGA
AGTGCAGGTGGTGGGAGTGAAGGACGATCGGATGGGGGAAGAGATTTGTGCCTGCATTCGGCTGAAGGAC
GGGGAGGAGACCACGGTGGAGGAGATAAAAGCTTTCTGCAAAGGGAAGATCTCTCACTTCAAGATTCCGA
AGTACATCGTGTTTGTCACAAACTACCCCCTCACCATTTCAGGAAAGATCCAGAAATTCAAACTTCGAGA
GCAGATGGAACGACATCTAAATCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204368 protein sequence
Red=Cloning site Green=Tags(s)

MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSYVQGCTKKHLN
SKTVVQCLETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLM
QLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENAQPGALKSQRL
PDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQFLSCHDPINIQFTSGTTGSPKGATLSHYNI
VNNSNILGERLKLHEKTPEQLRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERG
TFLYGTPTMFVDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAH
FPEDTVEQKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYW
TGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDRMGEEICACIRLKD
GEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKIQKFKLREQMERHLNL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_025149
ORF Size 1845 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025149.1, NM_025149.2, NM_025149.3, NM_025149.4, NM_025149.5, NP_079425.2
RefSeq Size 2245 bp
RefSeq ORF 1848 bp
Locus ID 80221
Cytogenetics 17q21.33
Domains AMP-binding
MW 68.2 kDa
Gene Summary Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipocyte differentiation. [UniProtKB/Swiss-Prot Function]

Citations (1)

Other Versions

Other products for "ACSF2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ACSF2 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools