TIFA (NM_052864) Human Tagged ORF Clone

CAT#: RC204357

Reviews ()
Write a review

TIFA (Myc-DDK-tagged)-Human TRAF-interacting protein with forkhead-associated domain (TIFA)



  "NM_052864" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TIFA
Synonyms T2BP; T6BP; TIFAA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204357 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCAGTTTTGAAGATGCTGACACAGAAGAGACAGTAACTTGTCTCCAGATGACGGTTTACCATCCTG
GCCAGTTGCAGTGTGGAATATTTCAGTCAATAAGTTTTAACAGAGAGAAACTCCCTTCCAGCGAAGTGGT
GAAATTTGGCCGAAATTCCAACATCTGTCATTATACTTTTCAGGACAAACAGGTTTCCCGAGTTCAGTTT
TCTCTGCAGCTGTTTAAAAAATTCAACAGCTCAGTTCTCTCCTTTGAAATAAAAAATATGAGTAAAAAGA
CCAATCTGATCGTGGACAGCAGAGAGCTGGGCTACCTAAATAAAATGGACCTGCCATACAGGTGCATGGT
CAGATTCGGAGAGTATCAGTTTCTGATGGAGAAGGAAGATGGCGAGTCATTGGAATTTTTTGAGACTCAA
TTTATTTTATCTCCAAGATCACTCTTGCAAGAAAACAACTGGCCACCACACAGGCCCATACCGGAGTATG
GCACTTACTCGCTCTGCTCCTCCCAAAGCAGTTCTCCGACAGAAATGGATGAAAATGAGTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204357 protein sequence
Red=Cloning site Green=Tags(s)

MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQF
SLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQ
FILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_052864
ORF Size 552 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_052864.3
RefSeq Size 3090 bp
RefSeq ORF 555 bp
Locus ID 92610
UniProt ID Q96CG3
Cytogenetics 4q25
MW 21.4 kDa
Gene Summary This gene encodes an adapter protein involved in adaptive and innate immunity. This protein includes a forkhead-associated (FHA) domain that specifically binds to phosphorylated serine and threonine residues. In response to bacterial infection, the encoded host cell protein undergoes an intermolecular interaction between the FHA domain and a phosphorylated threonine that leads to protein oligomerization and stimulation of the NF-kappa B and other downstream signaling pathways. This protein exhibits reduced expression in hepatocellular carcinoma and may suppress hepatocellular carcinoma progression. This protein may also play a role in the DNA damage response. [provided by RefSeq, Jun 2018]

Other Versions

Other products for "TIFA"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


TIFA Antibody - middle region
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.