FURIN(FURIN) (NM_002569) Human Tagged ORF Clone

CAT#: RC204279

FURIN (Myc-DDK-tagged)-Human furin (paired basic amino acid cleaving enzyme) (FURIN)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FURIN(FURIN) (NM_002569) Human Tagged ORF Clone
Symbol FURIN
Synonyms FUR; PACE; PCSK3; SPC1
Vector pCMV6-Entry
Sequence Data
>RC204279 representing NM_002569
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGAGGCCCTGGTTGCTATGGGTGGTAGCAGCAACAGGAACCTTGGTCCTGCTAGCAGCTGATG
CTCAGGGCCAGAAGGTCTTCACCAACACGTGGGCTGTGCGCATCCCTGGAGGCCCAGCGGTGGCCAACAG
TGTGGCACGGAAGCATGGGTTCCTCAACCTGGGCCAGATCTTCGGGGACTATTACCACTTCTGGCATCGA
GGAGTGACGAAGCGGTCCCTGTCGCCTCACCGCCCGCGGCACAGCCGGCTGCAGAGGGAGCCTCAAGTAC
AGTGGCTGGAACAGCAGGTGGCAAAGCGACGGACTAAACGGGACGTGTACCAGGAGCCCACAGACCCCAA
GTTTCCTCAGCAGTGGTACCTGTCTGGTGTCACTCAGCGGGACCTGAATGTGAAGGCGGCCTGGGCGCAG
GGCTACACAGGGCACGGCATTGTGGTCTCCATTCTGGACGATGGCATCGAGAAGAACCACCCGGACTTGG
CAGGCAATTATGATCCTGGGGCCAGTTTTGATGTCAATGACCAGGACCCTGACCCCCAGCCTCGGTACAC
ACAGATGAATGACAACAGGCACGGCACACGGTGTGCGGGGGAAGTGGCTGCGGTGGCCAACAACGGTGTC
TGTGGTGTAGGTGTGGCCTACAACGCCCGCATTGGAGGGGTGCGCATGCTGGATGGCGAGGTGACAGATG
CAGTGGAGGCACGCTCGCTGGGCCTGAACCCCAACCACATCCACATCTACAGTGCCAGCTGGGGCCCCGA
GGATGACGGCAAGACAGTGGATGGGCCAGCCCGCCTCGCCGAGGAGGCCTTCTTCCGTGGGGTTAGCCAG
GGCCGAGGGGGGCTGGGCTCCATCTTTGTCTGGGCCTCGGGGAACGGGGGCCGGGAACATGACAGCTGCA
ACTGCGACGGCTACACCAACAGTATCTACACGCTGTCCATCAGCAGCGCCACGCAGTTTGGCAACGTGCC
GTGGTACAGCGAGGCCTGCTCGTCCACACTGGCCACGACCTACAGCAGTGGCAACCAGAATGAGAAGCAG
ATCGTGACGACTGACTTGCGGCAGAAGTGCACGGAGTCTCACACGGGCACCTCAGCCTCTGCCCCCTTAG
CAGCCGGCATCATTGCTCTCACCCTGGAGGCCAATAAGAACCTCACATGGCGGGACATGCAACACCTGGT
GGTACAGACCTCGAAGCCAGCCCACCTCAATGCCAACGACTGGGCCACCAATGGTGTGGGCCGGAAAGTG
AGCCACTCATATGGCTACGGGCTTTTGGACGCAGGCGCCATGGTGGCCCTGGCCCAGAATTGGACCACAG
TGGCCCCCCAGCGGAAGTGCATCATCGACATCCTCACCGAGCCCAAAGACATCGGGAAACGGCTCGAGGT
GCGGAAGACCGTGACCGCGTGCCTGGGCGAGCCCAACCACATCACTCGGCTGGAGCACGCTCAGGCGCGG
CTCACCCTGTCCTATAATCGCCGTGGCGACCTGGCCATCCACCTGGTCAGCCCCATGGGCACCCGCTCCA
CCCTGCTGGCAGCCAGGCCACATGACTACTCCGCAGATGGGTTTAATGACTGGGCCTTCATGACAACTCA
TTCCTGGGATGAGGATCCCTCTGGCGAGTGGGTCCTAGAGATTGAAAACACCAGCGAAGCCAACAACTAT
GGGACGCTGACCAAGTTCACCCTCGTACTCTATGGCACCGCCCCTGAGGGGCTGCCCGTACCTCCAGAAA
GCAGTGGCTGCAAGACCCTCACGTCCAGTCAGGCCTGTGTGGTGTGCGAGGAAGGCTTCTCCCTGCACCA
GAAGAGCTGTGTCCAGCACTGCCCTCCAGGCTTCGCCCCCCAAGTCCTCGATACGCACTATAGCACCGAG
AATGACGTGGAGACCATCCGGGCCAGCGTCTGCGCCCCCTGCCACGCCTCATGTGCCACATGCCAGGGGC
CGGCCCTGACAGACTGCCTCAGCTGCCCCAGCCACGCCTCCTTGGACCCTGTGGAGCAGACTTGCTCCCG
GCAAAGCCAGAGCAGCCGAGAGTCCCCGCCACAGCAGCAGCCACCTCGGCTGCCCCCGGAGGTGGAGGCG
GGGCAACGGCTGCGGGCAGGGCTGCTGCCCTCACACCTGCCTGAGGTGGTGGCCGGCCTCAGCTGCGCCT
TCATCGTGCTGGTCTTCGTCACTGTCTTCCTGGTCCTGCAGCTGCGCTCTGGCTTTAGTTTTCGGGGGGT
GAAGGTGTACACCATGGACCGTGGCCTCATCTCCTACAAGGGGCTGCCCCCTGAAGCCTGGCAGGAGGAG
TGCCCGTCTGACTCAGAAGAGGACGAGGGCCGGGGCGAGAGGACCGCCTTTATCAAAGACCAGAGCGCCC
TC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204279 representing NM_002569
Red=Cloning site Green=Tags(s)

MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHR
GVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQ
GYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGV
CGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQ
GRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQ
IVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQAR
LTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNY
GTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTE
NDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEA
GQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEE
CPSDSEEDEGRGERTAFIKDQSAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_002569
ORF Size 2382 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002569.1, NM_002569.2, NM_002569.3, NP_002560
RefSeq Size 4180
RefSeq ORF 2385
Locus ID 5045
Cytogenetics 15q26.1
Domains Peptidase_S8, P_proprotein, FU
Protein Families Transmembrane, Protease, Druggable Genome
MW 86.5 kDa
Gene Summary This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. It encodes a type 1 membrane bound protease that is expressed in many tissues, including neuroendocrine, liver, gut, and brain. The encoded protein undergoes an initial autocatalytic processing event in the ER and then sorts to the trans-Golgi network through endosomes where a second autocatalytic event takes place and the catalytic activity is acquired. The product of this gene is one of the seven basic amino acid-specific members which cleave their substrates at single or paired basic residues. Some of its substrates include proparathyroid hormone, transforming growth factor beta 1 precursor, proalbumin, pro-beta-secretase, membrane type-1 matrix metalloproteinase, beta subunit of pro-nerve growth factor and von Willebrand factor. It is also thought to be one of the proteases responsible for the activation of HIV envelope glycoproteins gp160 and gp140 and may play a role in tumor progression. This gene is located in close proximity to family member proprotein convertase subtilisin/kexin type 6 and upstream of the FES oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)