GMP Synthase (GMPS) (NM_003875) Human Tagged ORF Clone

CAT#: RC204267

Reviews ()
Write a review

GMPS (Myc-DDK-tagged)-Human guanine monphosphate synthetase (GMPS)



  "NM_003875" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 635.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "GMPS"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GMPS
Synonyms GATD7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204267 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTGTGCAACGGAGACTCCAAGCTGGAGAATGCTGGAGGAGACCTTAAGGATGGCCACCACCACT
ATGAAGGAGCTGTTGTCATTCTGGATGCTGGTGCTCAGTACGGGAAAGTCATAGACCGAAGAGTGAGGGA
ACTGTTCGTGCAGTCTGAAATTTTCCCCTTGGAAACACCAGCATTTGCTATAAAGGAACAAGGATTCCGT
GCTATTATCATCTCTGGAGGACCTAATTCTGTGTATGCTGAAGATGCTCCCTGGTTTGATCCAGCAATAT
TCACTATTGGCAAGCCTGTTCTTGGAATTTGCTATGGTATGCAGATGATGAATAAGGTATTTGGAGGTAC
TGTGCACAAAAAAAGTGTCAGAGAAGATGGAGTTTTCAACATTAGTGTGGATAATACATGTTCATTATTC
AGGGGCCTTCAGAAGGAAGAAGTTGTTTTGCTTACACATGGAGATAGTGTAGACAAAGTAGCTGATGGAT
TCAAGGTTGTGGCACGTTCTGGAAACATAGTAGCAGGCATAGCAAATGAATCTAAAAAGTTATATGGAGC
ACAGTTCCACCCTGAAGTTGGCCTTACAGAAAATGGAAAAGTAATACTGAAGAATTTCCTTTATGATATA
GCTGGATGCAGTGGAACCTTCACCGTGCAGAACAGAGAACTTGAGTGTATTCGAGAGATCAAAGAGAGAG
TAGGCACGTCAAAAGTTTTGGTTTTACTCAGTGGTGGAGTAGACTCAACAGTTTGTACAGCTTTGCTAAA
TCGTGCTTTGAACCAAGAACAAGTCATTGCTGTGCACATTGATAATGGCTTTATGAGAAAACGAGAAAGC
CAGTCTGTTGAAGAGGCCCTCAAAAAGCTTGGAATTCAGGTCAAAGTGATAAATGCTGCTCATTCTTTCT
ACAATGGAACAACAACCCTACCAATATCAGATGAAGATAGAACCCCACGGAAAAGAATTAGCAAAACGTT
AAATATGACCACAAGTCCTGAAGAGAAAAGAAAAATCATTGGGGATACTTTTGTTAAGATTGCCAATGAA
GTAATTGGAGAAATGAACTTGAAACCAGAGGAGGTTTTCCTTGCCCAAGGTACTTTACGGCCTGATCTAA
TTGAAAGTGCATCCCTTGTTGCAAGTGGCAAAGCTGAACTCATCAAAACCCATCACAATGACACAGAGCT
CATCAGAAAGTTGAGAGAGGAGGGAAAAGTAATAGAACCTCTGAAAGATTTTCATAAAGATGAAGTGAGA
ATTTTGGGCAGAGAACTTGGACTTCCAGAAGAGTTAGTTTCCAGGCATCCATTTCCAGGTCCTGGCCTGG
CAATCAGAGTAATATGTGCTGAAGAACCTTATATTTGTAAGGACTTTCCTGAAACCAACAATATTTTGAA
AATAGTAGCTGATTTTTCTGCAAGTGTTAAAAAGCCACATACCCTATTACAGAGAGTCAAAGCCTGCACA
ACAGAAGAGGATCAGGAGAAGCTGATGCAAATTACCAGTCTGCATTCACTGAATGCCTTCTTGCTGCCAA
TTAAAACTGTAGGTGTGCAGGGTGACTGTCGTTCCTACAGTTACGTGTGTGGAATCTCCAGTAAAGATGA
ACCTGACTGGGAATCACTTATTTTTCTGGCTAGGCTTATACCTCGCATGTGTCACAACGTTAACAGAGTT
GTTTATATATTTGGCCCACCAGTTAAAGAACCTCCTACAGATGTTACTCCCACTTTCTTGACAACAGGGG
TGCTCAGTACTTTACGCCAAGCTGATTTTGAGGCCCATAACATTCTCAGGGAGTCTGGGTATGCTGGGAA
AATCAGCCAGATGCCGGTGATTTTGACACCATTACATTTTGATCGGGACCCACTTCAAAAGCAGCCTTCA
TGCCAGAGATCTGTGGTTATTCGAACCTTTATTACTAGTGACTTCATGACTGGTATACCTGCAACACCTG
GCAATGAGATCCCTGTAGAGGTGGTATTAAAGATGGTCACTGAGATTAAGAAGATTCCTGGTATTTCTCG
AATTATGTATGACTTAACATCAAAGCCCCCAGGAACTACTGAGTGGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204267 protein sequence
Red=Cloning site Green=Tags(s)

MALCNGDSKLENAGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFR
AIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLF
RGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDI
AGCSGTFTVQNRELECIREIKERVGTSKVLVLLSGGVDSTVCTALLNRALNQEQVIAVHIDNGFMRKRES
QSVEEALKKLGIQVKVINAAHSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANE
VIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVR
ILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACT
TEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNVNRV
VYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPS
CQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003875
ORF Size 2079 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003875.3
RefSeq Size 2457 bp
RefSeq ORF 2082 bp
Locus ID 8833
UniProt ID P49915
Cytogenetics 3q25.31
Domains GATase, GMP_synt_C
Protein Families Stem cell - Pluripotency
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism
MW 76.7 kDa
Gene Summary In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.