OSBP1 (OSBP) (NM_002556) Human Tagged ORF Clone

CAT#: RC204250

Reviews ()
Write a review

OSBP (Myc-DDK-tagged)-Human oxysterol binding protein (OSBP)



  "NM_002556" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 739.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "OSBP"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol OSBP
Synonyms OSBP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204250 representing NM_002556
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGACGGAGCTGAGAGGAGTGGTGGGGCCAGGCCCGGCAGCCATTGCAGCACTTGGCGGCGGCG
GCGCCGGTCCCCCAGTGGTGGGAGGAGGCGGCGGCCGCGGAGATGCGGGGCCAGGCTCCGGGGCCGCGTC
AGGGACGGTGGTCGCGGCGGCGGCGGGAGGCCCGGGCCCGGGGGCCGGGGGAGTGGCGGCGGCTGGCCCG
GCCCCTGCGCCGCCGACTGGGGGCTCGGGCGGCTCGGGCGCTGGGGGTTCGGGCTCGGCTCGAGAGGGCT
GGCTCTTCAAATGGACCAATTATATCAAAGGCTACCAGCGGCGATGGTTCGTGCTGAGCAACGGGCTCCT
GAGCTACTACAGATCAAAGGCAGAAATGAGACATACCTGCCGTGGTACCATCAACCTCGCCACAGCCAAC
ATCACCGTGGAGGACTCCTGCAACTTCATCATTTCCAATGGGGGTGCTCAGACCTACCATCTGAAAGCTA
GTTCAGAAGTTGAGCGGCAGCGCTGGGTGACGGCCCTGGAACTGGCCAAGGCCAAAGCTGTGAAGATGCT
GGCAGAGTCAGATGAATCAGGAGATGAAGAGTCTGTCTCACAAACTGACAAGACTGAGCTGCAGAATACC
CTTCGGACCCTCTCTAGCAAAGTAGAGGACTTGAGCACGTGCAATGACTTGATAGCTAAGCATGGCACAG
CTCTGCAGCGTTCTCTCAGTGAGCTGGAGTCCCTGAAGTTGCCTGCTGAGAGCAATGAAAAGATCAAACA
GGTCAACGAACGAGCCACACTCTTTAGGATAACATCCAATGCCATGATCAACGCCTGCAGAGATTTCCTC
ATGTTAGCCCAGACCCATAGTAAAAAATGGCAAAAGTCACTACAGTATGAAAGAGACCAGCGTATCCGAC
TGGAAGAAACCCTCGAGCAGCTGGCGAAGCAGCATAATCACCTGGAGAGGGCCTTCCGAGGAGCCACGGT
GCTGCCGGCAAACACTCCTGGCAATGTGGGTTCTGGTAAAGATCAGTGCTGCTCTGGCAAAGGGGACATG
AGCGATGAAGATGATGAGAATGAATTTTTTGATGCACCTGAGATCATCACCATGCCTGAAAATTTGGGCC
ACAAACGTACTGGCAGCAATATCAGTGGAGCCAGCAGTGACATCAGCCTTGATGAACAGTACAAGCATCA
GCTGGAGGAGACCAAAAAGGAAAAGAGAACCAGAATACCATACAAGCCAAACTATAGCCTCAATTTATGG
AGCATCATGAAGAACTGCATTGGAAAAGAACTCTCTAAGATCCCCATGCCGGTAAACTTTAATGAGCCCT
TGTCCATGCTTCAGCGCCTTACTGAAGATCTGGAATACCATGAGCTGTTAGACCGAGCTGCAAAATGTGA
GAATTCTCTAGAACAGCTCTGTTATGTTGCAGCTTTCACCGTGTCCTCCTACTCCACTACTGTCTTCCGC
ACCAGTAAGCCATTCAACCCACTGCTTGGGGAGACCTTTGAGCTGGACCGATTAGAGGAGAATGGGTACC
GATCCCTCTGTGAACAGGTGAGTCATCATCCCCCTGCTGCTGCGCACCATGCTGAGTCCAAAAATGGCTG
GACATTGCGTCAGGAAATCAAAATCACCAGCAAGTTTCGAGGCAAATACCTCTCCATTATGCCCCTCGGT
ACCATTCATTGTATTTTCCATGCAACTGGGCACCACTACACTTGGAAGAAAGTTACCACAACTGTACACA
ACATTATTGTGGGCAAGTTGTGGATAGATCAGTCTGGCGAAATTGATATTGTGAATCACAAGACAGGAGA
CAAGTGTAATCTTAAATTTGTTCCTTATAGCTACTTCTCTCGGGATGTAGCAAGAAAGGTGACGGGGGAA
GTGACAGATCCATCAGGAAAAGTCCACTTTGCTCTTCTGGGGACGTGGGATGAGAAAATGGAATGTTTCA
AAGTACAGCCAGTCATTGGGGAAAATGGGGGTGATGCTCGACAGAGAGGCCATGAAGCAGAGGAAAGCAG
GGTCATGCTGTGGAAAAGGAATCCTTTACCGAAGAATGCAGAAAACATGTACTACTTCTCAGAGCTTGCT
CTGACTCTCAATGCTTGGGAAAGTGGCACTGCCCCCACAGACAGCCGGTTACGACCTGACCAGAGACTGA
TGGAAAATGGACGCTGGGATGAAGCAAATGCGGAGAAGCAGCGCCTGGAGGAAAAACAAAGACTTTCCAG
AAAGAAGAGAGAAGCGGAAGCTATGAAAGCCACAGAGGATGGCACACCATATGATCCCTATAAGGCACTG
TGGTTTGAGCGGAAGAAGGACCCTGTTACCAAGGAGTTAACCCATATTTATAGGGGAGAATACTGGGAGT
GTAAAGAAAAACAGGACTGGAGCTCATGCCCGGACATTTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204250 representing NM_002556
Red=Cloning site Green=Tags(s)

MAATELRGVVGPGPAAIAALGGGGAGPPVVGGGGGRGDAGPGSGAASGTVVAAAAGGPGPGAGGVAAAGP
APAPPTGGSGGSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATAN
ITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDESGDEESVSQTDKTELQNT
LRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLKLPAESNEKIKQVNERATLFRITSNAMINACRDFL
MLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLERAFRGATVLPANTPGNVGSGKDQCCSGKGDM
SDEDDENEFFDAPEIITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLW
SIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFR
TSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLG
TIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGE
VTDPSGKVHFALLGTWDEKMECFKVQPVIGENGGDARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELA
LTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKAL
WFERKKDPVTKELTHIYRGEYWECKEKQDWSSCPDIF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002556
ORF Size 2421 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002556.3
RefSeq Size 5083 bp
RefSeq ORF 2424 bp
Locus ID 5007
UniProt ID P22059
Cytogenetics 11q12.1
Domains Oxysterol_BP, PH
Protein Families Druggable Genome
MW 89.2 kDa
Gene Summary Oxysterol binding protein is an intracellular protein that is believed to transport sterols from lysosomes to the nucleus where the sterol down-regulates the genes for the LDL receptor, HMG-CoA reductase, and HMG synthetase [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.