DHPS (NM_001930) Human Tagged ORF Clone

CAT#: RC204235

DHPS (Myc-DDK-tagged)-Human deoxyhypusine synthase (DHPS), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DHPS (NM_001930) Human Tagged ORF Clone
Symbol DHPS
Synonyms DHS; DS; MIG13
Vector pCMV6-Entry
Sequence Data
>RC204235 representing NM_001930
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGTTCCCTGGAACGGGAGGCGCCAGCGGGGGCGCTGGCCGCCGTGCTAAAGCACAGCTCGACGT
TGCCGCCCGAAAGCACCCAGGTCCGGGGCTACGACTTCAACCGCGGTGTGAATTACCGCGCACTGCTGGA
GGCCTTCGGCACCACCGGCTTCCAAGCAACCAACTTCGGGCGCGCTGTACAGCAAGTCAATGCCATGATC
GAGAAGAAGCTGGAACCACTGTCACAGGATGAAGACCAGCACGCGGACCTGACCCAGAGCCGCCGCCCAC
TTACCAGCTGCACCATTTTCCTGGGATATACATCCAACCTCATCAGTTCAGGCATCCGTGAGACCATTCG
CTACCTTGTGCAGCACAACATGGTGGACGTATTGGTGACCACAGCTGGCGGCGTGGAGGAAGACCTCATC
AAGTGCCTGGCGCCCACATACTTGGGCGAGTTTAGCCTCAGGGGGAAGGAGCTCCGGGAGAACGGGATCA
ATAGGATCGGAAACCTGCTGGTGCCCAATGAGAATTACTGCAAGTTTGAGGACTGGCTGATGCCCATTCT
GGACCAGATGGTGATGGAGCAGAACACAGAGGGTGTAAAGTGGACGCCTTCTAAGATGATCGCCCGGCTG
GGCAAGGAGATCAACAACCCAGAGTCCGTGTATTACTGGGCCCAGAAGAACCACATCCCTGTGTTTAGTC
CCGCACTTACAGACGGCTCGCTGGGCGACATGATCTTCTTCCATTCCTACAAGAACCCGGGCCTGGTCCT
GGACATCGTTGAGGACCTGAGGCTCATCAACACACAGGCCATCTTTGCCAAGTGCACTGGGATGATCATT
CTGGGCGGGGGCGTGGTCAAGCACCACATTGCCAATGCCAACCTCATGCGGAACGGGGCCGACTACGCTG
TTTACATCAACACAGCCCAGGAGTTTGATGGCTCTGACTCAGGTGCCCGACCAGACGAGGCTGTCTCCTG
GGGCAAGATCCGGGTGGATGCACAGCCCGTCAAGGTCTATGCTGACGCCTCCCTGGTCTTCCCCCTGCTT
GTGGCTGAAACCTTTGCCCAGAAGATGGATGCCTTCATGCATGAGAAGAATGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204235 representing NM_001930
Red=Cloning site Green=Tags(s)

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI
EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI
KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL
GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII
LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL
VAETFAQKMDAFMHEKNED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001930
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001930.1, NM_001930.2, NM_001930.3, NP_001921
RefSeq Size 1351
RefSeq ORF 1110
Locus ID 1725
Cytogenetics 19p13.13
Domains DS
MW 40.8 kDa
Gene Summary Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)