DHPS (NM_001930) Human Tagged ORF Clone

CAT#: RC204235

DHPS (Myc-DDK-tagged)-Human deoxyhypusine synthase (DHPS), transcript variant 1

 Cited in 1 publication.

  View "NM_001930" in other vectors (10)

USD 410.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DHPS (NM_001930) Human Tagged ORF Clone
Symbol DHPS
Synonyms DHS; DS; MIG13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204235 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGTTCCCTGGAACGGGAGGCGCCAGCGGGGGCGCTGGCCGCCGTGCTAAAGCACAGCTCGACGT
TGCCGCCCGAAAGCACCCAGGTCCGGGGCTACGACTTCAACCGCGGTGTGAATTACCGCGCACTGCTGGA
GGCCTTCGGCACCACCGGCTTCCAAGCAACCAACTTCGGGCGCGCTGTACAGCAAGTCAATGCCATGATC
GAGAAGAAGCTGGAACCACTGTCACAGGATGAAGACCAGCACGCGGACCTGACCCAGAGCCGCCGCCCAC
TTACCAGCTGCACCATTTTCCTGGGATATACATCCAACCTCATCAGTTCAGGCATCCGTGAGACCATTCG
CTACCTTGTGCAGCACAACATGGTGGACGTATTGGTGACCACAGCTGGCGGCGTGGAGGAAGACCTCATC
AAGTGCCTGGCGCCCACATACTTGGGCGAGTTTAGCCTCAGGGGGAAGGAGCTCCGGGAGAACGGGATCA
ATAGGATCGGAAACCTGCTGGTGCCCAATGAGAATTACTGCAAGTTTGAGGACTGGCTGATGCCCATTCT
GGACCAGATGGTGATGGAGCAGAACACAGAGGGTGTAAAGTGGACGCCTTCTAAGATGATCGCCCGGCTG
GGCAAGGAGATCAACAACCCAGAGTCCGTGTATTACTGGGCCCAGAAGAACCACATCCCTGTGTTTAGTC
CCGCACTTACAGACGGCTCGCTGGGCGACATGATCTTCTTCCATTCCTACAAGAACCCGGGCCTGGTCCT
GGACATCGTTGAGGACCTGAGGCTCATCAACACACAGGCCATCTTTGCCAAGTGCACTGGGATGATCATT
CTGGGCGGGGGCGTGGTCAAGCACCACATTGCCAATGCCAACCTCATGCGGAACGGGGCCGACTACGCTG
TTTACATCAACACAGCCCAGGAGTTTGATGGCTCTGACTCAGGTGCCCGACCAGACGAGGCTGTCTCCTG
GGGCAAGATCCGGGTGGATGCACAGCCCGTCAAGGTCTATGCTGACGCCTCCCTGGTCTTCCCCCTGCTT
GTGGCTGAAACCTTTGCCCAGAAGATGGATGCCTTCATGCATGAGAAGAATGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204235 protein sequence
Red=Cloning site Green=Tags(s)

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI
EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI
KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL
GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII
LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL
VAETFAQKMDAFMHEKNED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001930
ORF Size 1110 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001930.1, NM_001930.2, NM_001930.3, NP_001921
RefSeq Size 1361
RefSeq ORF 1110
Locus ID 1725
Cytogenetics 19p13.13
Domains DS
MW 41 kDa
Gene Summary This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011]

Citations (1)

Other Versions

Other products for "DHPS"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


anti-DHPS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
    • 100 ul

USD 379.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones