DHPS (NM_001930) Human Tagged ORF Clone

CAT#: RC204235

Reviews ()
Write a review

DHPS (Myc-DDK-tagged)-Human deoxyhypusine synthase (DHPS), transcript variant 1



  "NM_001930" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DHPS
Synonyms DHS; DS; MIG13; NEDSSWI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204235 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGGTTCCCTGGAACGGGAGGCGCCAGCGGGGGCGCTGGCCGCCGTGCTAAAGCACAGCTCGACGT
TGCCGCCCGAAAGCACCCAGGTCCGGGGCTACGACTTCAACCGCGGTGTGAATTACCGCGCACTGCTGGA
GGCCTTCGGCACCACCGGCTTCCAAGCAACCAACTTCGGGCGCGCTGTACAGCAAGTCAATGCCATGATC
GAGAAGAAGCTGGAACCACTGTCACAGGATGAAGACCAGCACGCGGACCTGACCCAGAGCCGCCGCCCAC
TTACCAGCTGCACCATTTTCCTGGGATATACATCCAACCTCATCAGTTCAGGCATCCGTGAGACCATTCG
CTACCTTGTGCAGCACAACATGGTGGACGTATTGGTGACCACAGCTGGCGGCGTGGAGGAAGACCTCATC
AAGTGCCTGGCGCCCACATACTTGGGCGAGTTTAGCCTCAGGGGGAAGGAGCTCCGGGAGAACGGGATCA
ATAGGATCGGAAACCTGCTGGTGCCCAATGAGAATTACTGCAAGTTTGAGGACTGGCTGATGCCCATTCT
GGACCAGATGGTGATGGAGCAGAACACAGAGGGTGTAAAGTGGACGCCTTCTAAGATGATCGCCCGGCTG
GGCAAGGAGATCAACAACCCAGAGTCCGTGTATTACTGGGCCCAGAAGAACCACATCCCTGTGTTTAGTC
CCGCACTTACAGACGGCTCGCTGGGCGACATGATCTTCTTCCATTCCTACAAGAACCCGGGCCTGGTCCT
GGACATCGTTGAGGACCTGAGGCTCATCAACACACAGGCCATCTTTGCCAAGTGCACTGGGATGATCATT
CTGGGCGGGGGCGTGGTCAAGCACCACATTGCCAATGCCAACCTCATGCGGAACGGGGCCGACTACGCTG
TTTACATCAACACAGCCCAGGAGTTTGATGGCTCTGACTCAGGTGCCCGACCAGACGAGGCTGTCTCCTG
GGGCAAGATCCGGGTGGATGCACAGCCCGTCAAGGTCTATGCTGACGCCTCCCTGGTCTTCCCCCTGCTT
GTGGCTGAAACCTTTGCCCAGAAGATGGATGCCTTCATGCATGAGAAGAATGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204235 protein sequence
Red=Cloning site Green=Tags(s)

MEGSLEREAPAGALAAVLKHSSTLPPESTQVRGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMI
EKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLI
KCLAPTYLGEFSLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARL
GKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMII
LGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLL
VAETFAQKMDAFMHEKNED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001930
ORF Size 1107 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001930.4
RefSeq Size 1361 bp
RefSeq ORF 1110 bp
Locus ID 1725
UniProt ID P49366
Cytogenetics 19p13.13
Domains DS
MW 41 kDa
Gene Summary This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011]

Other Versions

Other products for "DHPS"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Anti-DHPS mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.