Integrin beta 7 (ITGB7) (NM_000889) Human Tagged ORF Clone

CAT#: RC204193

Reviews ()
Write a review

ITGB7 (Myc-DDK-tagged)-Human integrin, beta 7 (ITGB7)



  "NM_000889" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 731.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "ITGB7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ITGB7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204193 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGCTTTGCCAATGGTCCTTGTTTTGCTGCTGGTCCTGAGCAGAGGTGAGAGTGAATTGGACGCCA
AGATCCCATCCACAGGGGATGCCACAGAATGGCGGAATCCTCACCTGTCCATGCTGGGGTCCTGCCAGCC
AGCCCCCTCCTGCCAGAAGTGCATCCTCTCACACCCCAGCTGTGCATGGTGCAAGCAACTGAACTTCACC
GCGTCGGGAGAGGCGGAGGCGCGGCGCTGCGCCCGACGAGAGGAGCTGCTGGCTCGAGGCTGCCCGCTGG
AGGAGCTGGAGGAGCCCCGCGGCCAGCAGGAGGTGCTGCAGGACCAGCCGCTCAGCCAGGGCGCCCGCGG
AGAGGGTGCCACCCAGCTGGCGCCGCAGCGGGTCCGGGTCACGCTGCGGCCTGGGGAGCCCCAGCAGCTC
CAGGTCCGCTTCCTTCGTGCTGAGGGATACCCGGTGGACCTGTACTACCTTATGGACCTGAGCTACTCCA
TGAAGGACGACCTGGAACGCGTGCGCCAGCTCGGGCACGCTCTGCTGGTCCGGCTGCAGGAAGTCACCCA
TTCTGTGCGCATTGGTTTTGGTTCCTTTGTGGACAAAACGGTGCTGCCCTTTGTGAGCACAGTACCCTCC
AAACTGCGCCACCCCTGCCCCACCCGGCTGGAGCGCTGCCAGTCACCATTCAGCTTTCACCATGTGCTGT
CCCTGACGGGGGACGCACAAGCCTTCGAGCGGGAGGTGGGGCGCCAGAGTGTGTCCGGCAATCTGGACTC
GCCTGAAGGTGGCTTCGATGCCATTCTGCAGGCTGCACTCTGCCAGGAGCAGATTGGCTGGAGAAATGTG
TCCCGGCTGCTGGTGTTCACTTCAGACGACACATTCCATACAGCTGGGGACGGGAAGTTGGGCGGCATTT
TCATGCCCAGTGATGGGCACTGCCACTTGGACAGCAATGGCCTCTACAGTCGCAGCACAGAGTTTGACTA
CCCTTCTGTGGGTCAGGTAGCCCAGGCCCTCTCTGCAGCAAATATCCAGCCCATCTTTGCTGTCACCAGT
GCCGCACTGCCTGTCTACCAGGAGCTGAGTAAACTGATTCCTAAGTCTGCAGTTGGGGAGCTGAGTGAGG
ACTCCAGCAACGTGGTACAGCTCATCATGGATGCTTATAATAGCCTGTCTTCCACCGTGACCCTTGAACA
CTCTTCACTCCCTCCTGGGGTCCACATTTCTTACGAATCCCAGTGTGAGGGTCCTGAGAAGAGGGAGGGT
AAGGCTGAGGATCGAGGACAGTGCAACCACGTCCGAATCAACCAGACGGTGACTTTCTGGGTTTCTCTCC
AAGCCACCCACTGCCTCCCAGAGCCCCATCTCCTGAGGCTCCGGGCCCTTGGCTTCTCAGAGGAGCTGAT
TGTGGAGTTGCACACGCTGTGTGACTGTAATTGCAGTGACACCCAGCCCCAGGCTCCCCACTGCAGTGAT
GGCCAGGGACACCTACAATGTGGTGTATGCAGCTGTGCCCCTGGCCGCCTAGGTCGGCTCTGTGAGTGCT
CTGTGGCAGAGCTGTCCTCCCCAGACCTGGAATCTGGGTGCCGGGCTCCCAATGGCACAGGGCCCCTGTG
CAGTGGAAAGGGTCACTGTCAATGTGGACGCTGCAGCTGCAGTGGACAGAGCTCTGGGCATCTGTGCGAG
TGTGACGATGCCAGCTGTGAGCGACATGAGGGCATCCTCTGCGGAGGCTTTGGTCGCTGCCAATGTGGAG
TATGTCACTGTCATGCCAACCGCACGGGCAGAGCATGCGAATGCAGTGGGGACATGGACAGTTGCATCAG
TCCCGAGGGAGGGCTCTGCAGTGGGCATGGACGCTGCAAATGCAACCGCTGCCAGTGCTTGGACGGCTAC
TATGGTGCTCTATGCGACCAATGCCCAGGCTGCAAGACACCATGCGAGAGACACCGGGACTGTGCAGAGT
GTGGGGCCTTCAGGACTGGCCCACTGGCCACCAACTGCAGTACAGCTTGTGCCCATACCAATGTGACCCT
GGCCTTGGCCCCTATCTTGGATGATGGCTGGTGCAAAGAGCGGACCCTGGACAACCAGCTGTTCTTCTTC
TTGGTGGAGGATGACGCCAGAGGCACGGTCGTGCTCAGAGTGAGACCCCAAGAAAAGGGAGCAGACCACA
CGCAGGCCATTGTGCTGGGCTGCGTAGGGGGCATCGTGGCAGTGGGGCTGGGGCTGGTCCTGGCTTACCG
GCTCTCGGTGGAAATCTATGACCGCCGGGAATACAGTCGCTTTGAGAAGGAGCAGCAACAACTCAACTGG
AAGCAGGACAGTAATCCTCTCTACAAAAGTGCCATCACGACCACCATCAATCCTCGCTTTCAAGAGGCAG
ACAGTCCCACTCTC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC204193 protein sequence
Red=Cloning site Green=Tags(s)

MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPSCAWCKQLNFT
ASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQL
QVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPS
KLRHPCPTRLERCQSPFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNV
SRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTS
AALPVYQELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSD
GQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCE
CDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDSCISPEGGLCSGHGRCKCNRCQCLDGY
YGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFF
LVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNW
KQDSNPLYKSAITTTINPRFQEADSPTL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000889
ORF Size 2394 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000889.3
RefSeq Size 2878 bp
RefSeq ORF 2397 bp
Locus ID 3695
UniProt ID P26010
Cytogenetics 12q13.13
Domains INB, PSI
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cell adhesion molecules (CAMs), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Regulation of actin cytoskeleton
MW 86.9 kDa
Gene Summary This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms dimers with an alpha4 chain or an alphaE chain and plays a role in leukocyte adhesion. Dimerization with alpha4 forms a homing receptor for migration of lymphocytes to the intestinal mucosa and Peyer's patches. Dimerization with alphaE permits binding to the ligand epithelial cadherin, a calcium-dependent adhesion molecule. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Rabbit Polyclonal Anti-ITGB7 Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.