PHKA2 (NM_000292) Human Tagged ORF Clone

CAT#: RC204185

Reviews ()
Write a review

PHKA2 (Myc-DDK-tagged)-Human phosphorylase kinase, alpha 2 (liver) (PHKA2)



  "NM_000292" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,075.00

USD 1,612.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "PHKA2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PHKA2
Synonyms GSD9A; PHK; PYK; PYKL; XLG; XLG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204185 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGAGCAGGAGCAATTCCGGGGTCCGCTTGGACGGGTACGCGCGGCTGGTGCAGCAAACCATCCTGT
GTTACCAGAATCCCGTCACGGGGCTGCTGTCAGCCAGCCATGAGCAGAAGGATGCCTGGGTGCGGGATAA
CATCTACAGTATCCTGGCCGTGTGGGGCCTGGGCATGGCCTACCGTAAGAATGCAGACCGCGATGAGGAC
AAGGCCAAGGCCTACGAGCTGGAGCAGAACGTGGTGAAGCTGATGCGAGGTCTTCTCCAGTGCATGATGA
GACAGGTGGCCAAAGTGGAGAAGTTCAAACACACTCAGAGCACCAAGGACAGCCTGCACGCCAAGTACAA
CACCGCCACCTGTGGCACGGTGGTGGGCGACGACCAGTGGGGCCACCTCCAGGTGGATGCCACCTCTCTC
TTCCTCCTGTTCCTGGCCCAGATGACCGCCTCAGGCTTACGTATCATTTTCACTCTCGATGAGGTGGCCT
TCATACAGAATCTTGTCTTTTACATAGAAGCTGCATATAAAGTCGCTGATTATGGAATGTGGGAGCGTGG
AGATAAGACTAATCAGGGCATCCCGGAATTGAATGCAAGCTCCGTAGGAATGGCCAAGGCAGCTCTTGAG
GCAATTGATGAACTGGACCTTTTTGGAGCCCATGGAGGACGCAAGTCAGTGATTCATGTTCTGCCAGATG
AGGTCGAGCACTGCCAGTCTATTCTGTTCTCCATGCTGCCAAGAGCGTCGACATCTAAAGAAATTGATGC
TGGACTTCTTTCCATTATTTCCTTCCCGGCCTTTGCAGTGGAAGATGTAAACCTTGTAAATGTGACCAAA
AATGAAATTATTTCTAAGCTCCAGGGGCGTTATGGATGCTGTCGCTTCCTTCGAGATGGTTATAAAACTC
CAAGAGAGGACCCTAATCGACTGCATTATGACCCTGCTGAACTCAAGCTCTTCGAAAACATTGAATGTGA
GTGGCCTGTGTTTTGGACATATTTTATAATAGATGGAGTCTTCAGTGGTGATGCTGTTCAGGTCCAAGAA
TACCGAGAGGCCCTGGAGGGAATACTCATCAGAGGCAAGAATGGGATCCGCCTGGTGCCTGAACTCTACG
CTGTCCCGCCTAACAAGGTAGATGAAGAGTACAAGAATCCTCACACAGTAGACCGAGTTCCTATGGGGAA
GGTGCCTCATCTGTGGGGCCAATCCTTGTACATCCTCAGCTCGCTGTTGGCAGAGGGATTCCTTGCCGCT
GGTGAAATCGATCCCTTAAATAGAAGATTTTCCACTTCAGTCAAACCTGATGTTGTAGTACAAGTTACTG
TTTTGGCAGAAAACAATCACATTAAGGACTTATTGAGGAAACACGGGGTGAACGTCCAGAGTATCGCGGA
CATTCATCCAATTCAAGTCCAGCCGGGCCGGATTCTTAGTCACATATATGCCAAGCTTGGACGGAATAAG
AATATGAATTTGAGTGGGCGACCGTATCGACATATTGGTGTCCTTGGAACCTCTAAACTATATGTGATTA
GGAACCAAATCTTTACTTTTACACCCCAGTTCACCGACGAGCATCACTTCTACCTGGCCCTCGACAATGA
GATGATCGTGGAGATGCTAAGGATCGAGCTGGCCTACCTGTGCACCTGCTGGAGGATGACGGGCAGACCC
ACACTCACCTTCCCCATCAGTCGCACCATGCTCACAAATGATGGCTCAGACATTCATTCTGCTGTGCTCT
CCACAATTAGAAAACTAGAGGATGGATATTTTGGAGGAGCCAGAGTAAAATTAGGGAACCTTTCGGAATT
TCTCACCACATCGTTCTACACATATCTGACTTTTCTGGATCCAGACTGTGATGAGAAGTTGTTTGACAAT
GCCAGCGAAGGGACTTTCAGTCCTGATAGTGATTCAGATTTGGTAGGATATCTGGAAGACACCTGTAATC
AAGAAAGCCAAGACGAACTTGACCATTATATCAACCACCTTCTGCAAAGCACATCGTTGAGGTCCTATCT
GCCTCCTCTTTGTAAGAACACAGAAGACCGCCATGTCTTCAGTGCTATCCACTCCACGCGGGACATACTT
TCTGTGATGGCAAAAGCAAAGGGTTTGGAAGTTCCATTTGTTCCCATGACTTTGCCGACTAAAGTTCTAA
GTGCCCACCGTAAATCACTGAATCTTGTTGATTCTCCTCAGCCACTCCTAGAAAAGGTTCCTGAAAGTGA
CTTTCAGTGGCCCAGAGATGACCATAGTGACGTGGACTGTGAGAAGCTGGTTGAGCAGCTAAAAGATTGT
TCGAACCTACAGGACCAAGCAGACATTCTGTACATTCTTTATGTCATAAAGGGTCCCAGCTGGGACACAA
ATCTCTCTGGACAGCACGGGGTCACCGTTCAAAACCTTCTTGGTGAGCTCTATGGGAAAGCCGGCTTGAA
CCAGGAGTGGGGTCTGATTCGCTACATCTCAGGCCTTCTCAGGAAGAAAGTGGAGGTCCTGGCTGAGGCC
TGCACAGACCTGCTTTCGCACCAGAAGCAGCTCACCGTGGGCCTGCCGCCCGAGCCCCGGGAGAAGATCA
TCTCTGCGCCCCTTCCCCCAGAGGAGCTCACAAAACTCATCTACGAGGCCAGTGGGCAGGACATCAGCAT
TGCCGTCCTCACGCAGGAGATTGTGGTTTACCTGGCCATGTATGTCAGGGCGCAGCCCAGCCTCTTTGTG
GAGATGCTGAGACTCCGGATTGGACTGATCATTCAGGTGATGGCCACGGAGCTGGCACGGAGCCTGAACT
GCTCAGGAGAAGAGGCTTCTGAAAGTTTGATGAACCTCAGCCCTTTCGATATGAAAAATCTCCTGCACCA
TATTCTAAGTGGGAAAGAGTTTGGCGTTGAAAGAAGTGTGCGCCCTATCCACTCCTCCACATCCAGCCCT
ACCATCTCCATCCACGAGGTGGGCCATACCGGAGTCACCAAAACTGAGAGGAGTGGCATTAACAGACTGA
GGAGTGAAATGAAACAGATGACTAGGCGGTTTAGTGCTGATGAACAGTTCTTTTCTGTGGGCCAGGCCGC
GTCCAGCAGTGCGCATTCCTCCAAGTCTGCGAGGTCCAGCACCCCATCCTCGCCCACTGGCACGTCATCC
TCAGACTCGGGAGGACATCACATCGGCTGGGGTGAGCGGCAGGGCCAGTGGCTGCGCAGGAGAAGGCTGG
ATGGGGCCATCAACAGGGTCCCCGTGGGATTCTACCAGAGGGTGTGGAAGATCCTCCAGAAGTGCCACGG
TCTCTCCATCGATGGTTATGTCCTCCCATCCTCGACGACCCGAGAGATGACCCCGCATGAGATCAAGTTT
GCTGTCCATGTCGAATCGGTGCTGAACCGCGTGCCGCAGCCCGAGTACCGGCAGCTGCTGGTGGAAGCCA
TCATGGTGCTGACGCTGCTCTCGGACACGGAGATGACCAGCATCGGGGGCATCATCCACGTGGACCAGAT
CGTGCAGATGGCCAGTCAGCTGTTCTTGCAGGACCAGGTGTCAATTGGTGCCATGGACACCCTGGAGAAA
GACCAAGCCACAGGAATCTGCCACTTCTTTTATGACAGCGCTCCGAGTGGGGCTTATGGGACGATGACCT
ACCTAACAAGAGCAGTGGCTTCTTATTTGCAGGAATTGTTGCCCAATTCGGGCTGCCAGATGCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204185 protein sequence
Red=Cloning site Green=Tags(s)

MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHEQKDAWVRDNIYSILAVWGLGMAYRKNADRDED
KAKAYELEQNVVKLMRGLLQCMMRQVAKVEKFKHTQSTKDSLHAKYNTATCGTVVGDDQWGHLQVDATSL
FLLFLAQMTASGLRIIFTLDEVAFIQNLVFYIEAAYKVADYGMWERGDKTNQGIPELNASSVGMAKAALE
AIDELDLFGAHGGRKSVIHVLPDEVEHCQSILFSMLPRASTSKEIDAGLLSIISFPAFAVEDVNLVNVTK
NEIISKLQGRYGCCRFLRDGYKTPREDPNRLHYDPAELKLFENIECEWPVFWTYFIIDGVFSGDAVQVQE
YREALEGILIRGKNGIRLVPELYAVPPNKVDEEYKNPHTVDRVPMGKVPHLWGQSLYILSSLLAEGFLAA
GEIDPLNRRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILSHIYAKLGRNK
NMNLSGRPYRHIGVLGTSKLYVIRNQIFTFTPQFTDEHHFYLALDNEMIVEMLRIELAYLCTCWRMTGRP
TLTFPISRTMLTNDGSDIHSAVLSTIRKLEDGYFGGARVKLGNLSEFLTTSFYTYLTFLDPDCDEKLFDN
ASEGTFSPDSDSDLVGYLEDTCNQESQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDIL
SVMAKAKGLEVPFVPMTLPTKVLSAHRKSLNLVDSPQPLLEKVPESDFQWPRDDHSDVDCEKLVEQLKDC
SNLQDQADILYILYVIKGPSWDTNLSGQHGVTVQNLLGELYGKAGLNQEWGLIRYISGLLRKKVEVLAEA
CTDLLSHQKQLTVGLPPEPREKIISAPLPPEELTKLIYEASGQDISIAVLTQEIVVYLAMYVRAQPSLFV
EMLRLRIGLIIQVMATELARSLNCSGEEASESLMNLSPFDMKNLLHHILSGKEFGVERSVRPIHSSTSSP
TISIHEVGHTGVTKTERSGINRLRSEMKQMTRRFSADEQFFSVGQAASSSAHSSKSARSSTPSSPTGTSS
SDSGGHHIGWGERQGQWLRRRRLDGAINRVPVGFYQRVWKILQKCHGLSIDGYVLPSSTTREMTPHEIKF
AVHVESVLNRVPQPEYRQLLVEAIMVLTLLSDTEMTSIGGIIHVDQIVQMASQLFLQDQVSIGAMDTLEK
DQATGICHFFYDSAPSGAYGTMTYLTRAVASYLQELLPNSGCQMQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000292
ORF Size 3705 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000292.3
RefSeq Size 5325 bp
RefSeq ORF 3708 bp
Locus ID 5256
UniProt ID P46019
Cytogenetics Xp22.13
Protein Families Druggable Genome
Protein Pathways Calcium signaling pathway, Insulin signaling pathway
MW 138.4 kDa
Gene Summary Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the hepatic isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9A, also known as X-linked liver glycogenosis. Alternatively spliced transcript variants have been reported, but the full-length nature of these variants has not been determined.[provided by RefSeq, Feb 2010]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.