GNB2 (NM_005273) Human Tagged ORF Clone

CAT#: RC204178

GNB2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GNB2 (NM_005273) Human Tagged ORF Clone
Symbol GNB2
Synonyms G protein, beta-2 subunit; OTTHUMP00000174601; OTTHUMP00000174602; guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2; guanine nucleotide-binding protein, beta-2 subunit; signal-transducing guanine nucleotide-binding regulatory protein beta
Vector pCMV6-Entry
Sequence Data
>RC204178 representing NM_005273
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGAGCTGGAGCAACTGAGACAGGAGGCCGAGCAGCTCCGGAACCAGATCCGGGATGCCCGAAAAG
CATGTGGGGACTCAACACTGACCCAGATCACAGCTGGGCTGGACCCAGTGGGGAGAATCCAGATGAGGAC
CCGGAGGACCCTCCGTGGGCACCTGGCAAAGATCTATGCCATGCACTGGGGGACCGACTCAAGGCTGCTG
GTCAGCGCCTCCCAGGATGGGAAGCTCATCATCTGGGACAGCTACACCACCAACAAGGTCCACGCCATCC
CGCTGCGCTCCTCCTGGGTAATGACCTGTGCCTACGCGCCCTCAGGGAACTTTGTGGCCTGTGGGGGGTT
GGACAACATCTGCTCCATCTACAGCCTCAAGACCCGCGAGGGCAACGTCAGGGTCAGCCGGGAGCTGCCT
GGCCACACTGGGTACCTGTCGTGTTGCCGCTTCCTGGATGACAACCAAATCATCACCAGCTCTGGGGATA
CCACCTGTGCCCTGTGGGACATTGAGACAGGCCAGCAGACAGTGGGTTTTGCTGGACACAGTGGGGATGT
GATGTCCCTGTCCCTGGCCCCCGATGGCCGCACGTTTGTGTCAGGCGCCTGTGATGCCTCTATCAAGCTG
TGGGACGTGCGGGATTCCATGTGCCGACAGACCTTCATCGGCCATGAATCCGACATCAATGCAGTGGCTT
TCTTCCCCAACGGCTACGCCTTCACCACCGGCTCTGACGACGCCACGTGCCGCCTCTTCGACCTGCGGGC
CGATCAGGAGCTCCTCATGTACTCCCATGACAACATCATCTGTGGCATCACCTCTGTTGCCTTCTCGCGC
AGCGGACGGCTGCTGCTCGCTGGCTACGACGACTTCAACTGCAACATCTGGGATGCCATGAAGGGCGACC
GTGCAGGAGTCCTCGCTGGCCACGACAACCGCGTGAGCTGCCTTGGGGTCACCGACGATGGCATGGCTGT
GGCCACGGGCTCCTGGGACTCCTTCCTCAAGATCTGGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204178 representing NM_005273
Red=Cloning site Green=Tags(s)

MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELP
GHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKL
WDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSR
SGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005273
ORF Size 1020 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005273.1, NM_005273.2, NM_005273.3, NP_005264
RefSeq Size 1666
RefSeq ORF 1023
Locus ID 2783
Cytogenetics 7q22.1
Domains WD40
Protein Pathways Chemokine signaling pathway
MW 37.2 kDa
Gene Summary Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)