DDX3(DDX3X) (NM_001356) Human Tagged ORF Clone

CAT#: RC204171

DDX3X (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked (DDX3X), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DDX3(DDX3X) (NM_001356) Human Tagged ORF Clone
Symbol DDX3X
Synonyms CAP-Rf; DBX; DDX14; DDX3; HLP2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204171 representing NM_001356
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCATGTGGCAGTGGAAAATGCGCTCGGGCTGGACCAGCAGTTTGCTGGCCTAGACCTGAACTCTT
CAGATAATCAGAGTGGAGGAAGTACAGCCAGCAAAGGGCGCTATATTCCTCCTCATTTAAGGAACCGAGA
AGCTACTAAAGGTTTCTACGATAAAGACAGTTCAGGGTGGAGTTCTAGCAAAGATAAGGATGCGTATAGC
AGTTTTGGATCTCGTAGTGATTCAAGAGGGAAGTCTAGCTTCTTCAGTGATCGTGGAAGTGGATCAAGGG
GAAGGTTTGATGATCGTGGACGGAGTGATTACGATGGCATTGGCAGCCGTGGTGACAGAAGTGGCTTTGG
CAAATTTGAACGTGGTGGAAACAGTCGCTGGTGTGACAAATCAGATGAAGATGATTGGTCAAAACCACTC
CCACCAAGTGAACGCTTGGAACAGGAACTCTTTTCTGGAGGCAACACTGGGATTAATTTTGAGAAATACG
ATGACATTCCAGTTGAGGCAACAGGCAACAACTGTCCTCCACATATTGAAAGTTTCAGTGATGTTGAGAT
GGGAGAAATTATCATGGGAAACATTGAGCTTACTCGTTATACTCGCCCAACTCCAGTGCAAAAGCATGCT
ATTCCTATTATCAAAGAGAAAAGAGACTTGATGGCTTGTGCCCAAACAGGGTCTGGAAAAACTGCAGCAT
TTCTGTTGCCCATCTTGAGTCAGATTTATTCAGATGGTCCAGGCGAGGCTTTGAGGGCCATGAAGGAAAA
TGGAAGGTATGGGCGCCGCAAACAATACCCAATCTCCTTGGTATTAGCACCAACGAGAGAGTTGGCAGTA
CAGATCTACGAGGAAGCCAGAAAATTTTCATACCGATCTAGAGTTCGTCCTTGCGTGGTTTATGGTGGTG
CCGATATTGGTCAGCAGATTCGAGACTTGGAACGTGGATGCCATTTGTTAGTAGCCACTCCAGGACGTCT
AGTGGATATGATGGAAAGAGGAAAGATTGGATTAGACTTTTGCAAATACTTGGTGTTAGATGAAGCTGAT
CGGATGTTGGATATGGGGTTTGAGCCTCAGATTCGTAGAATAGTCGAACAAGATACTATGCCTCCAAAGG
GTGTCCGCCACACTATGATGTTTAGTGCTACTTTTCCTAAGGAAATACAGATGCTGGCTCGTGATTTCTT
AGATGAATATATCTTCTTGGCTGTAGGAAGAGTTGGCTCTACCTCTGAAAACATCACACAGAAAGTAGTT
TGGGTGGAAGAATCAGACAAACGGTCATTTCTGCTTGACCTCCTAAATGCAACAGGCAAGGATTCACTGA
CCTTAGTGTTTGTGGAGACCAAAAAGGGTGCAGATTCTCTGGAGGATTTCTTATACCATGAAGGATACGC
ATGTACCAGCATCCATGGAGACCGTTCTCAGAGGGATAGAGAAGAGGCCCTTCACCAGTTCCGCCCAGGA
AAAAGCCCAATTTTAGTGGCTACAGCAGTAGCAGCAAGAGGACTGGACATTTCAAATGTGAAACATGTTA
TCAATTTTGACTTGCCAAGTGATATTGAAGAATATGTACATCGTATTGGTCGTACGGGACGTGTAGGAAA
CCTTGGCCTGGCAACCTCATTCTTTAACGAGAGGAACATAAATATTACTAAGGATTTGTTGGATCTTCTT
GTTGAAGCTAAACAAGAAGTGCCGTCTTGGTTAGAAAACATGGCTTATGAACACCACTACAAGGGTAGCA
GTCGTGGACGTTCTAAGAGTAGCAGATTTAGTGGAGGGTTTGGTGCCAGAGACTACCGACAAAGTAGCGG
TGCCAGCAGTTCCAGCTTCAGCAGCAGCCGCGCAAGCAGCAGCCGCAGTGGCGGAGGTGGCCACGGTAGC
AGCAGAGGATTTGGTGGAGGTGGCTATGGAGGCTTTTACAACAGTGATGGATATGGAGGAAATTATAACT
CCCAGGGGGTTGACTGGTGGGGTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204171 representing NM_001356
Red=Cloning site Green=Tags(s)

MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS
SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL
PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA
IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV
QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD
RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRPG
KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL
VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS
SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001356
ORF Size 1986 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001356.1, NM_001356.2, NM_001356.3, NM_001356.4, NP_001347
RefSeq Size 5433
RefSeq ORF 1989
Locus ID 1654
Cytogenetics Xp11.4
Domains DEAD, helicase_C
Protein Families ES Cell Differentiation/IPS
Protein Pathways RIG-I-like receptor signaling pathway
MW 73.1 kDa
Gene Summary The protein encoded by this gene is a member of the large DEAD-box protein family, that is defined by the presence of the conserved Asp-Glu-Ala-Asp (DEAD) motif, and has ATP-dependent RNA helicase activity. This protein has been reported to display a high level of RNA-independent ATPase activity, and unlike most DEAD-box helicases, the ATPase activity is thought to be stimulated by both RNA and DNA. This protein has multiple conserved domains and is thought to play roles in both the nucleus and cytoplasm. Nuclear roles include transcriptional regulation, mRNP assembly, pre-mRNA splicing, and mRNA export. In the cytoplasm, this protein is thought to be involved in translation, cellular signaling, and viral replication. Misregulation of this gene has been implicated in tumorigenesis. This gene has a paralog located in the nonrecombining region of the Y chromosome. Pseudogenes sharing similarity to both this gene and the DDX3Y paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)