DDX3 (DDX3X) (NM_001356) Human Tagged ORF Clone

CAT#: RC204171

Reviews ()
Write a review
  • TrueORF®

DDX3X (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked (DDX3X), transcript variant 1



  "NM_001356" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DDX3X
Synonyms CAP-Rf; DBX; DDX3; DDX14; HLP2; MRX102; MRXSSB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204171 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCATGTGGCAGTGGAAAATGCGCTCGGGCTGGACCAGCAGTTTGCTGGCCTAGACCTGAACTCTT
CAGATAATCAGAGTGGAGGAAGTACAGCCAGCAAAGGGCGCTATATTCCTCCTCATTTAAGGAACCGAGA
AGCTACTAAAGGTTTCTACGATAAAGACAGTTCAGGGTGGAGTTCTAGCAAAGATAAGGATGCGTATAGC
AGTTTTGGATCTCGTAGTGATTCAAGAGGGAAGTCTAGCTTCTTCAGTGATCGTGGAAGTGGATCAAGGG
GAAGGTTTGATGATCGTGGACGGAGTGATTACGATGGCATTGGCAGCCGTGGTGACAGAAGTGGCTTTGG
CAAATTTGAACGTGGTGGAAACAGTCGCTGGTGTGACAAATCAGATGAAGATGATTGGTCAAAACCACTC
CCACCAAGTGAACGCTTGGAACAGGAACTCTTTTCTGGAGGCAACACTGGGATTAATTTTGAGAAATACG
ATGACATTCCAGTTGAGGCAACAGGCAACAACTGTCCTCCACATATTGAAAGTTTCAGTGATGTTGAGAT
GGGAGAAATTATCATGGGAAACATTGAGCTTACTCGTTATACTCGCCCAACTCCAGTGCAAAAGCATGCT
ATTCCTATTATCAAAGAGAAAAGAGACTTGATGGCTTGTGCCCAAACAGGGTCTGGAAAAACTGCAGCAT
TTCTGTTGCCCATCTTGAGTCAGATTTATTCAGATGGTCCAGGCGAGGCTTTGAGGGCCATGAAGGAAAA
TGGAAGGTATGGGCGCCGCAAACAATACCCAATCTCCTTGGTATTAGCACCAACGAGAGAGTTGGCAGTA
CAGATCTACGAGGAAGCCAGAAAATTTTCATACCGATCTAGAGTTCGTCCTTGCGTGGTTTATGGTGGTG
CCGATATTGGTCAGCAGATTCGAGACTTGGAACGTGGATGCCATTTGTTAGTAGCCACTCCAGGACGTCT
AGTGGATATGATGGAAAGAGGAAAGATTGGATTAGACTTTTGCAAATACTTGGTGTTAGATGAAGCTGAT
CGGATGTTGGATATGGGGTTTGAGCCTCAGATTCGTAGAATAGTCGAACAAGATACTATGCCTCCAAAGG
GTGTCCGCCACACTATGATGTTTAGTGCTACTTTTCCTAAGGAAATACAGATGCTGGCTCGTGATTTCTT
AGATGAATATATCTTCTTGGCTGTAGGAAGAGTTGGCTCTACCTCTGAAAACATCACACAGAAAGTAGTT
TGGGTGGAAGAATCAGACAAACGGTCATTTCTGCTTGACCTCCTAAATGCAACAGGCAAGGATTCACTGA
CCTTAGTGTTTGTGGAGACCAAAAAGGGTGCAGATTCTCTGGAGGATTTCTTATACCATGAAGGATACGC
ATGTACCAGCATCCATGGAGACCGTTCTCAGAGGGATAGAGAAGAGGCCCTTCACCAGTTCCGCTCAGGA
AAAAGCCCAATTTTAGTGGCTACAGCAGTAGCAGCAAGAGGACTGGACATTTCAAATGTGAAACATGTTA
TCAATTTTGACTTGCCAAGTGATATTGAAGAATATGTACATCGTATTGGTCGTACGGGACGTGTAGGAAA
CCTTGGCCTGGCAACCTCATTCTTTAACGAGAGGAACATAAATATTACTAAGGATTTGTTGGATCTTCTT
GTTGAAGCTAAACAAGAAGTGCCGTCTTGGTTAGAAAACATGGCTTATGAACACCACTACAAGGGTAGCA
GTCGTGGACGTTCTAAGAGTAGCAGATTTAGTGGAGGGTTTGGTGCCAGAGACTACCGACAAAGTAGCGG
TGCCAGCAGTTCCAGCTTCAGCAGCAGCCGCGCAAGCAGCAGCCGCAGTGGCGGAGGTGGCCACGGTAGC
AGCAGAGGATTTGGTGGAGGTGGCTATGGAGGCTTTTACAACAGTGATGGATATGGAGGAAATTATAACT
CCCAGGGGGTTGACTGGTGGGGTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204171 protein sequence
Red=Cloning site Green=Tags(s)

MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS
SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL
PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA
IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV
QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD
RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSG
KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL
VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS
SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001356
ORF Size 1986 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001356.5
RefSeq Size 5433 bp
RefSeq ORF 1989 bp
Locus ID 1654
UniProt ID O00571
Cytogenetics Xp11.4
Domains DEAD, helicase_C
Protein Families ES Cell Differentiation/IPS
Protein Pathways RIG-I-like receptor signaling pathway
MW 73.2 kDa
Gene Summary The protein encoded by this gene is a member of the large DEAD-box protein family, that is defined by the presence of the conserved Asp-Glu-Ala-Asp (DEAD) motif, and has ATP-dependent RNA helicase activity. This protein has been reported to display a high level of RNA-independent ATPase activity, and unlike most DEAD-box helicases, the ATPase activity is thought to be stimulated by both RNA and DNA. This protein has multiple conserved domains and is thought to play roles in both the nucleus and cytoplasm. Nuclear roles include transcriptional regulation, mRNP assembly, pre-mRNA splicing, and mRNA export. In the cytoplasm, this protein is thought to be involved in translation, cellular signaling, and viral replication. Misregulation of this gene has been implicated in tumorigenesis. This gene has a paralog located in the nonrecombining region of the Y chromosome. Pseudogenes sharing similarity to both this gene and the DDX3Y paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Other Versions

Other products for "DDX3X"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.