ID4 (NM_001546) Human Tagged ORF Clone

CAT#: RC204170

Reviews ()
Write a review

ID4 (Myc-DDK-tagged)-Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4)


 Cited in 1 publication.

  "NM_001546" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ID4 (NM_001546) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ID4
Synonyms bHLHb27; IDB4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204170 representing NM_001546
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGCGGTGAGCCCGGTGCGCCCCTCGGGCCGCAAGGCGCCGTCGGGCTGCGGCGGCGGGGAGCTGG
CGCTGCGCTGCCTGGCCGAGCACGGCCACAGCCTGGGTGGCTCCGCAGCCGCGGCGGCGGCGGCGGCGGC
AGCGCGCTGTAAGGCGGCCGAGGCGGCGGCCGACGAGCCGGCGCTGTGCCTGCAGTGCGATATGAACGAC
TGCTATAGCCGCCTGCGGAGGCTGGTGCCCACCATCCCGCCCAACAAGAAAGTCAGCAAAGTGGAGATCC
TGCAGCACGTTATCGACTACATCCTGGACCTGCAGCTGGCGCTGGAGACGCACCCGGCCCTGCTGAGGCA
GCCACCACCGCCCGCGCCGCCACACCACCCGGCCGGGACCTGTCCAGCCGCGCCGCCGCGGACCCCGCTC
ACTGCGCTCAACACCGACCCGGCCGGCGCGGTGAACAAGCAGGGCGACAGCATTCTGTGCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204170 representing NM_001546
Red=Cloning site Green=Tags(s)

MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND
CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL
TALNTDPAGAVNKQGDSILCR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001546
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001546.1, NM_001546.2, NM_001546.3, NP_001537.1
RefSeq Size 2389
RefSeq ORF 486
Locus ID 3400
Cytogenetics 6p22.3
Domains HLH
Protein Families ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways TGF-beta signaling pathway
MW 16.4 kDa
Gene Summary This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017]

Citations (1)

Other Versions

Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools