CBX6(CBX6) (NM_014292) Human Tagged ORF Clone

CAT#: RC204166

CBX6 (Myc-DDK-tagged)-Human chromobox homolog 6 (CBX6)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CBX6(CBX6) (NM_014292) Human Tagged ORF Clone
Symbol CBX6
Synonyms OTTHUMP00000028667; chromobox homolog 6
Vector pCMV6-Entry
Sequence Data
>RC204166 representing NM_014292
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTGTCTGCAGTGGGCGAGCGGGTCTTCGCGGCCGAATCCATCATCAAACGGCGGATCCGAAAGG
GACGCATCGAGTACCTGGTGAAATGGAAGGGGTGGGCGATCAAGTACAGCACTTGGGAGCCCGAGGAGAA
CATCCTGGACTCGCGGCTCATTGCAGCCTTCGAACAAAAGGAGAGGGAGCGTGAGCTGTATGGGCCCAAG
AAGAGGGGACCCAAACCCAAAACTTTCCTCCTGAAGGCGCGGGCCCAGGCCGAGGCCCTCCGCATCAGTG
ATGTGCATTTCTCTGTCAAGCCGAGCGCCAGTGCCTCCTCGCCCAAGCTGCACTCCAGCGCAGCCGTGCA
CCGGCTCAAGAAGGACATCCGCCGCTGCCACCGTATGTCCCGCCGTCCCCTGCCCCGCCCGGACCCGCAG
GGGGGCAGCCCCGGACTGCGCCCGCCCATTTCGCCCTTCTCGGAGACGGTGCGCATCATCAACCGCAAGG
TGAAGCCGCGGGAGCCCAAGCGGAACCGCATCATCCTGAACCTGAAGGTGATCGACAAGGGCGCTGGCGG
CGGGGGCGCCGGGCAGGGGGCCGGGGCGCTGGCCCGCCCCAAAGTCCCCTCGCGGAACCGCGTTATAGGC
AAGAGCAAGAAGTTCAGCGAGAGCGTCCTGCGTACACAGATCCGCCACATGAAGTTCGGCGCCTTTGCGC
TGTACAAGCCTCCGCCCGCCCCCCTGGTAGCCCCGTCCCCCGGCAAGGCTGAGGCCTCAGCCCCGGGCCC
TGGGCTACTTCTGGCCGCCCCCGCCGCCCCCTACGACGCCCGCAGCTCTGGCTCCTCCGGCTGCCCCTCG
CCTACACCACAGTCCTCTGACCCCGACGACACGCCCCCCAAGCTCCTCCCCGAGACCGTGAGCCCATCCG
CCCCCAGCTGGCGCGAGCCGGAGGTGCTCGACCTGTCCCTCCCTCCCGAGTCGGCAGCCACCAGCAAGCG
GGCACCGCCTGAGGTCACAGCTGCTGCCGGCCCGGCACCTCCCACGGCCCCTGAGCCCGCCGGTGCCTCC
TCCGAGCCCGAGGCTGGGGACTGGCGCCCCGAGATGTCACCCTGCTCCAATGTGGTCGTCACCGATGTCA
CCAGCAACCTCCTGACGGTCACAATCAAGGAATTCTGCAACCCTGAGGATTTCGAGAAGGTGGCTGCTGG
GGTAGCAGGCGCCGCTGGGGGCGGTGGCAGCATTGGGGCGAGCAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204166 representing NM_014292
Red=Cloning site Green=Tags(s)

MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQKERERELYGPK
KRGPKPKTFLLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQ
GGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIG
KSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPS
PTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAAGPAPPTAPEPAGAS
SEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCNPEDFEKVAAGVAGAAGGGGSIGASK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014292
ORF Size 1236 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014292.1, NM_014292.2, NM_014292.3, NM_014292.4, NP_055107
RefSeq Size 3284
RefSeq ORF 1239
Locus ID 23466
Cytogenetics 22q13.1
Protein Families Transcription Factors
MW 43.7 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)