BTD (NM_000060) Human Tagged ORF Clone

CAT#: RC204153

Reviews ()
Write a review

BTD (Myc-DDK-tagged)-Human biotinidase (BTD)



  "NM_000060" in other vectors (4)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name BTD (NM_000060) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BTD
Synonyms biotinidase
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC204153 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCATGCGCATATTCAGGGCGGAAGGCGCGCTAAGAGCAGATTTGTGGTCTGCATTATGTCTGGAG
CCAGAAGTAAGCTTGCTCTTTTCCTCTGCGGCTGTTACGTGGTTGCCCTGGGAGCCCACACCGGGGAGGA
GAGCGTGGCTGACCATCACGAGGCTGAATATTATGTGGCTGCCGTGTATGAGCATCCATCCATCCTGAGT
CTGAACCCTCTGGCTCTCATCAGCCGCCAAGAGGCCTTGGAGCTCATGAACCAGAACCTTGACATCTATG
AACAGCAAGTGATGACTGCAGCCCAAAAGGATGTACAGATTATAGTGTTTCCAGAAGATGGCATTCATGG
ATTCAACTTTACAAGAACATCCATTTATCCATTTTTGGACTTCATGCCGTCTCCCCAGGTGGTCAGGTGG
AACCCATGCCTGGAGCCTCACCGCTTCAATGACACAGAGGTGCTCCAGCGCCTGAGTTGTATGGCCATCA
GGGGAGATATGTTCTTGGTGGCCAATCTTGGGACAAAGGAGCCTTGTCATAGCAGTGACCCAAGGTGCCC
AAAAGATGGGAGATACCAGTTCAACACAAATGTCGTGTTCAGCAATAATGGAACCCTTGTTGACCGCTAC
CGTAAACACAACCTCTACTTTGAGGCAGCATTCGATGTTCCTCTTAAAGTGGATCTCATCACCTTTGATA
CCCCCTTTGCTGGCAGGTTTGGCATCTTCACATGCTTTGATATATTGTTCTTTGACCCTGCCATCAGAGT
CCTCAGAGACTACAAGGTGAAGCATGTTGTGTACCCAACTGCCTGGATGAACCAGCTCCCACTCTTGGCA
GCAATTGAGATTCAGAAAGCTTTTGCTGTTGCCTTTGGCATCAACGTTCTGGCAGCTAATGTCCACCACC
CAGTTCTGGGGATGACAGGAAGTGGCATACACACCCCTCTGGAGTCCTTTTGGTACCATGACATGGAAAA
TCCCAAAAGTCACCTTATAATTGCCCAGGTGGCCAAAAATCCAGTGGGTCTCATTGGTGCAGAGAATGCA
ACAGGTGAAACGGACCCATCCCATAGTAAGTTTTTAAAAATTTTGTCAGGCGATCCGTACTGTGAGAAGG
ATGCTCAGGAAGTCCACTGTGATGAGGCCACCAAGTGGAACGTGAATGCTCCTCCCACATTTCACTCTGA
GATGATGTATGACAATTTCACCCTGGTCCCTGTCTGGGGAAAGGAAGGCTATCTCCACGTCTGTTCCAAT
GGCCTCTGCTGTTATTTACTTTACGAGAGGCCCACCTTATCCAAAGAGCTGTATGCCCTGGGGGTCTTTG
ATGGGCTTCACACAGTACATGGCACTTACTACATCCAAGTGTGTGCCCTGGTCAGGTGTGGGGGTCTTGG
CTTCGACACCTGTGGACAGGAAATCACAGAGGCCACGGGGATATTTGAGTTTCACCTGTGGGGCAACTTC
AGTACTTCCTATATCTTTCCTTTGTTTCTGACCTCAGGGATGACCCTAGAAGTCCCTGACCAGCTTGGCT
GGGAGAATGACCACTATTTCCTGAGGAAAAGTAGGCTGTCCTCTGGGCTGGTGACGGCGGCTCTCTATGG
GCGCTTGTATGAGAGGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204153 protein sequence
Red=Cloning site Green=Tags(s)

MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILS
LNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRW
NPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRY
RKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLA
AIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENA
TGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSN
GLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNF
STSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000060
ORF Size 1629 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000060.1, NM_000060.2, NM_000060.3, NM_000060.4, NP_000051.1
RefSeq Size 2084 bp
RefSeq ORF 1632 bp
Locus ID 686
Cytogenetics 3p25.1
Domains CN_hydrolase
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Biotin metabolism, Metabolic pathways
MW 61.1 kDa
Gene Summary The protein encoded by this gene functions to recycle protein-bound biotin by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in regeneration of free biotin. The encoded protein has also been shown to have biotinyl transferase activity. Mutations in this gene are associated with biotinidase deficiency. Multiple transcript variants encoding different isoforms have been described. [provided by RefSeq, Aug 2013]

Citations (1)

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools