ETFDH (NM_004453) Human Tagged ORF Clone

CAT#: RC204149

ETFDH (Myc-DDK-tagged)-Human electron-transferring-flavoprotein dehydrogenase (ETFDH), nuclear gene encoding mitochondrial protein

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name ETFDH (NM_004453) Human Tagged ORF Clone
Symbol ETFDH
Synonyms ETFQO; MADD
Vector pCMV6-Entry
Sequence Data
>RC204149 representing NM_004453
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGTGCCGCTAGCCAAGCTGTCCTGCCTGGCATATCAGTGCTTTCATGCCTTAAAAATTAAGAAAA
ATTATCTACCTCTATGTGCTATAAGATGGTCTTCAACTTCTACTGTGCCTCGAATTACTACCCATTATAC
TATTTATCCCCGGGATAAGGACAAGAGATGGGAAGGAGTGAACATGGAAAGGTTTGCAGAAGAAGCAGAT
GTTGTAATAGTTGGTGCAGGCCCTGCAGGGCTCTCTGCAGCTGTTCGTCTAAAACAGTTGGCTGTGGCAC
ATGAAAAGGACATCCGTGTGTGTCTAGTGGAGAAAGCTGCCCAGATAGGAGCTCATACTCTCTCAGGGGC
TTGCCTTGATCCAGGTGCTTTTAAAGAACTCTTCCCAGACTGGAAAGAGAAGGGGGCTCCACTTAACACT
CCTGTAACAGAAGACAGATTTGGAATTTTAACAGAGAAATACAGAATTCCTGTGCCAATTCTTCCAGGGC
TTCCAATGAATAATCATGGCAATTACATTGTACGCTTGGGACATTTAGTGAGCTGGATGGGCGAACAAGC
AGAAGCCCTTGGTGTTGAAGTATACCCTGGTTATGCAGCTGCTGAGGTCCTTTTTCATGATGATGGTAGT
GTAAAAGGAATTGCCACTAACGATGTAGGGATACAAAAGGATGGTGCACCAAAGGCAACATTTGAGAGAG
GACTGGAACTACATGCTAAAGTCACAATTTTTGCAGAAGGTTGCCATGGACATCTAGCCAAGCAACTATA
TAAGAAGTTTGATTTGAGAGCAAATTGTGAACCTCAAACCTACGGGATTGGACTGAAGGAGTTATGGGTT
ATTGATGAAAAGAACTGGAAACCTGGGAGAGTAGATCACACTGTTGGTTGGCCCTTGGACAGACATACCT
ATGGAGGATCTTTCCTCTATCATTTGAATGAAGGTGAACCCCTAGTAGCTCTTGGTCTTGTGGTTGGTCT
AGACTATCAGAATCCATACCTGAGTCCATTTAGAGAGTTCCAAAGGTGGAAACACCATCCTAGCATTCGG
CCAACCTTGGAAGGTGGAAAAAGGATTGCATACGGAGCCAGAGCTCTCAATGAAGGTGGCTTTCAGTCTA
TACCAAAACTCACCTTTCCTGGTGGTTTACTAATTGGTTGTAGTCCTGGTTTTATGAATGTTCCCAAGAT
CAAAGGTACTCACACAGCAATGAAAAGTGGAATTTTAGCAGCAGAATCTATTTTTAATCAACTAACTAGT
GAAAATCTCCAATCAAAGACAATAGGACTCCATGTAACTGAATATGAGGACAATTTGAAGAACTCATGGG
TATGGAAAGAGCTATATTCTGTTAGAAATATAAGACCGTCCTGCCACGGAGTACTGGGTGTATATGGAGG
GATGATTTACACTGGAATCTTTTACTGGATATTGAGAGGAATGGAGCCGTGGACTCTGAAACATAAAGGT
TCTGACTTTGAACGGCTCAAGCCAGCCAAGGATTGCACACCTATTGAGTATCCAAAACCCGATGGACAGA
TCAGTTTTGACCTCTTGTCATCTGTGGCTCTGAGTGGTACTAATCATGAACATGACCAGCCGGCACACTT
AACCTTAAGGGATGACAGTATACCTGTAAATAGAAATCTGTCGATATATGATGGGCCCGAGCAGCGATTC
TGTCCTGCAGGAGTTTATGAATTTGTACCTGTGGAACAAGGTGATGGATTTCGGTTACAGATAAATGCTC
AGAACTGTGTACATTGTAAAACATGTGATATTAAAGATCCAAGTCAGAATATTAACTGGGTGGTACCTGA
AGGTGGAGGAGGACCTGCTTACAATGGAATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204149 representing NM_004453
Red=Cloning site Green=Tags(s)

MLVPLAKLSCLAYQCFHALKIKKNYLPLCAIRWSSTSTVPRITTHYTIYPRDKDKRWEGVNMERFAEEAD
VVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNT
PVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLFHDDGS
VKGIATNDVGIQKDGAPKATFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWV
IDEKNWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIR
PTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHKG
SDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNLSIYDGPEQRF
CPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004453
ORF Size 1851 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004453.1, NM_004453.2, NM_004453.3, NP_004444
RefSeq Size 2349
RefSeq ORF 1854
Locus ID 2110
Cytogenetics 4q32.1
Domains ETFD
MW 68.51 kDa
Gene Summary This gene encodes a component of the electron-transfer system in mitochondria and is essential for electron transfer from a number of mitochondrial flavin-containing dehydrogenases to the main respiratory chain. Mutations in this gene are associated with glutaric acidemia. Alternatively spliced transcript variants that encode distinct isoforms have been observed. [provided by RefSeq, Aug 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)