HDGF (NM_004494) Human Tagged ORF Clone

CAT#: RC204148

HDGF (Myc-DDK-tagged)-Human hepatoma-derived growth factor (HDGF), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HDGF (NM_004494) Human Tagged ORF Clone
Symbol HDGF
Synonyms HMG1L2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204148 representing NM_004494
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGATCCAACCGGCAGAAGGAGTACAAATGCGGGGACCTGGTGTTCGCCAAGATGAAGGGCTACC
CACACTGGCCGGCCCGGATTGACGAGATGCCTGAGGCTGCCGTGAAATCAACAGCCAACAAATACCAAGT
CTTTTTTTTCGGGACCCACGAGACGGCATTCCTGGGCCCCAAAGACCTCTTCCCTTACGAGGAATCCAAG
GAGAAGTTTGGCAAGCCCAACAAGAGGAAAGGGTTCAGCGAGGGGCTGTGGGAGATCGAAAACAACCCTA
CTGTCAAGGCTTCCGGCTATCAGTCCTCCCAGAAAAAGAGCTGTGTGGAAGAGCCTGAACCAGAGCCCGA
AGCTGCAGAGGGTGACGGTGATAAGAAGGGGAATGCAGAGGGCAGCAGCGACGAGGAAGGGAAGCTGGTC
ATTGATGAGCCAGCCAAGGAGAAGAACGAGAAAGGAGCGTTGAAGAGGAGAGCAGGGGACTTGCTGGAGG
ACTCTCCTAAACGTCCCAAGGAGGCAGAAAACCCTGAAGGAGAGGAGAAGGAGGCAGCCACCTTGGAGGT
TGAGAGGCCCCTTCCTATGGAGGTGGAAAAGAATAGCACCCCCTCTGAGCCCGGCTCTGGCCGGGGGCCT
CCCCAAGAGGAAGAAGAAGAGGAGGATGAAGAGGAAGAGGCTACCAAGGAAGATGCTGAGGCCCCAGGCA
TCAGAGATCATGAGAGCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204148 representing NM_004494
Red=Cloning site Green=Tags(s)

MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESK
EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLV
IDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNSTPSEPGSGRGP
PQEEEEEEDEEEEATKEDAEAPGIRDHESL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004494
ORF Size 720 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004494.1, NM_004494.2, NP_004485
RefSeq Size 2376
RefSeq ORF 723
Locus ID 3068
Cytogenetics 1q23.1
Domains PWWP
MW 26.6 kDa
Gene Summary This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)