STK38 (NM_007271) Human Tagged ORF Clone

CAT#: RC204133

Reviews ()
Write a review

STK38 (Myc-DDK-tagged)-Human serine/threonine kinase 38 (STK38)



  "NM_007271" in other vectors (7)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol STK38
Synonyms NDR; NDR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204133 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAATGACAGGCTCAACACCTTGCTCATCCATGAGTAACCACACAAAGGAAAGGGTGACAATGACCA
AAGTGACACTGGAGAATTTTTATAGCAACCTTATCGCTCAACATGAAGAACGAGAAATGAGACAAAAGAA
GTTAGAAAAGGTGATGGAAGAAGAAGGCCTAAAAGATGAGGAGAAACGACTCCGGAGATCAGCACATGCT
CGGAAGGAAACAGAGTTTCTTCGTTTGAAGAGAACAAGACTTGGATTGGAAGATTTTGAGTCCTTAAAAG
TAATAGGCAGAGGAGCATTTGGTGAGGTACGGCTTGTTCAGAAGAAAGATACGGGACATGTGTATGCAAT
GAAAATACTCCGTAAAGCAGATATGCTTGAAAAAGAGCAGGTTGGCCACATTCGTGCGGAGCGTGACATT
CTAGTGGAGGCAGACAGTTTGTGGGTTGTGAAAATGTTCTATAGTTTTCAGGATAAGCTAAACCTCTACC
TAATCATGGAGTTCCTGCCTGGAGGGGACATGATGACCTTGTTGATGAAAAAAGACACTCTGACAGAAGA
GGAGACTCAGTTTTATATAGCAGAAACAGTATTAGCCATAGACTCTATTCACCAACTTGGATTCATCCAC
AGAGACATCAAACCAGACAACCTTCTTTTGGACAGCAAGGGCCATGTGAAACTTTCTGACTTTGGTCTTT
GCACAGGACTGAAAAAAGCACATAGGACAGAATTTTATAGGAATCTGAACCACAGCCTCCCCAGTGATTT
CACTTTCCAGAACATGAATTCCAAAAGGAAAGCAGAAACCTGGAAAAGAAATAGACGTCAGCTAGCCTTC
TCCACAGTAGGCACTCCTGACTACATTGCTCCTGAGGTGTTCATGCAGACCGGGTACAACAAGCTCTGTG
ATTGGTGGTCGCTTGGGGTGATCATGTATGAGATGCTCATCGGCTACCCACCTTTCTGTTCTGAGACCCC
TCAAGAGACATATAAGAAGGTGATGAACTGGAAAGAAACTTTGACTTTTCCTCCAGAAGTTCCCATCTCT
GAGAAAGCCAAGGATCTAATTTTGAGGTTCTGCTGTGAATGGGAACATAGAATTGGAGCTCCTGGAGTTG
AGGAAATAAAAAGTAACTCTTTTTTTGAAGGCGTTGACTGGGAACATATCAGAGAGAGACCTGCTGCAAT
ATCTATTGAAATCAAAAGCATTGATGATACCTCAAACTTCGATGAGTTTCCAGAATCTGATATTCTTAAG
CCAACAGTGGCCACAAGTAATCATCCTGAGACTGACTACAAGAACAAAGACTGGGTCTTCATCAATTACA
CGTACAAGCGCTTTGAGGGCCTGACTGCAAGGGGGGCAATACCTTCCTACATGAAAGCAGCAAAA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC204133 protein sequence
Red=Cloning site Green=Tags(s)

MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA
RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI
LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH
RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS
EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK
PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007271
ORF Size 1395 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007271.4
RefSeq Size 3593 bp
RefSeq ORF 1398 bp
Locus ID 11329
UniProt ID Q15208
Cytogenetics 6p21.31
Domains pkinase, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
MW 54.2 kDa
Gene Summary This gene encodes a member of the AGC serine/threonine kinase family of proteins. The kinase activity of this protein is regulated by autophosphorylation and phosphorylation by other upstream kinases. This protein has been shown to function in the cell cycle and apoptosis. This protein has also been found to regulate the protein stability and transcriptional activity of the MYC oncogene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Other Versions

Other products for "STK38"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Goat Polyclonal Antibody against NDR1 / STK38
    • 100 ug

USD 429.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.