SLC33A1 (NM_004733) Human Tagged ORF Clone

CAT#: RC204131

SLC33A1 (Myc-DDK-tagged)-Human solute carrier family 33 (acetyl-CoA transporter), member 1 (SLC33A1), transcript variant 1

Change vector?

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SLC33A1 (NM_004733) Human Tagged ORF Clone
Symbol SLC33A1
Synonyms ACATN; AT-1; AT1; CCHLND; SPG42
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204131 representing NM_004733
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACCCACCATCTCCCACAAGGACAGCAGCCGGCAACGGCGGCCAGGGAATTTCAGTCACTCTCTGG
ATATGAAGAGCGGTCCCCTGCCGCCAGGCGGTTGGGATGACAGTCATTTGGACTCAGCGGGCCGGGAAGG
GGACAGAGAAGCTCTTCTGGGGGATACCGGCACTGGCGACTTCTTAAAAGCCCCACAGAGCTTCCGGGCC
GAACTAAGCAGCATTTTGCTACTACTCTTTCTTTACGTGCTTCAGGGTATTCCCCTGGGCTTGGCGGGAA
GCATCCCACTCATTTTGCAAAGCAAAAATGTTAGCTATACAGACCAAGCTTTCTTCAGTTTTGTCTTTTG
GCCCTTCAGTCTCAAATTACTCTGGGCCCCGTTGGTTGATGCGGTCTACGTTAAGAACTTCGGTCGTCGC
AAATCTTGGCTTGTCCCGACACAGTATATACTAGGACTCTTCATGATCTATTTATCCACTCAGGTGGACC
GTTTGCTTGGGAATACCGATGACAGAACACCCGACGTGATTGCTCTCACTGTGGCGTTCTTTTTGTTTGA
ATTCTTGGCCGCCACTCAGGACATTGCCGTCGATGGTTGGGCGTTAACTATGTTATCCAGGGAAAATGTG
GGTTATGCTTCTACTTGCAATTCGGTGGGCCAAACAGCGGGTTACTTTTTGGGCAATGTTTTGTTTTTGG
CCCTTGAATCTGCCGACTTTTGTAACAAATATTTGCGGTTTCAGCCTCAACCCAGAGGAATCGTTACTCT
TTCAGATTTCCTTTTTTTCTGGGGAACTGTATTTTTAATAACAACAACATTGGTTGCCCTTCTGAAAAAA
GAAAACGAAGTATCAGTAGTAAAAGAAGAAACACAAGGGATCACAGATACTTACAAGCTGCTTTTTGCAA
TTATAAAAATGCCAGCAGTTCTGACATTTTGCCTTCTGATTCTAACTGCAAAGATTGGTTTTTCAGCAGC
AGATGCTGTAACAGGACTGAAATTGGTAGAAGAGGGAGTACCCAAAGAACATTTAGCCTTATTGGCAGTT
CCAATGGTTCCTTTGCAGATAATACTGCCTCTGATTATCAGCAAATACACTGCAGGTCCCCAGCCATTAA
ACACATTTTACAAAGCCATGCCCTACAGATTATTGCTTGGGTTAGAATATGCCCTACTGGTTTGGTGGAC
TCCTAAAGTAGAACATCAAGGGGGATTCCCTATATATTACTATATCGTAGTCCTGCTGAGTTATGCTTTA
CATCAGGTTACAGTGTACAGCATGTATGTTTCTATAATGGCTTTCAATGCAAAGGTTAGTGATCCACTTA
TTGGAGGAACATACATGACCCTTTTAAATACCGTGTCCAATCTGGGAGGAAACTGGCCTTCTACAGTAGC
TCTTTGGCTTGTAGATCCCCTCACAGTAAAAGAGTGTGTAGGAGCATCAAACCAGAATTGTCGAACACCT
GATGCTGTTGAGCTTTGCAAAAAACTGGGTGGCTCATGTGTTACAGCCCTGGATGGTTATTATGTGGAGT
CCATTATTTGTGTTTTCATTGGATTTGGTTGGTGGTTCTTTCTTGGTCCAAAATTTAAAAAGTTACAGGA
TGAAGGATCATCTTCGTGGAAATGCAAAAGGAACAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204131 representing NM_004733
Red=Cloning site Green=Tags(s)

MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRA
ELSSILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFSLKLLWAPLVDAVYVKNFGRR
KSWLVPTQYILGLFMIYLSTQVDRLLGNTDDRTPDVIALTVAFFLFEFLAATQDIAVDGWALTMLSRENV
GYASTCNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKK
ENEVSVVKEETQGITDTYKLLFAIIKMPAVLTFCLLILTAKIGFSAADAVTGLKLVEEGVPKEHLALLAV
PMVPLQIILPLIISKYTAGPQPLNTFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPIYYYIVVLLSYAL
HQVTVYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKECVGASNQNCRTP
DAVELCKKLGGSCVTALDGYYVESIICVFIGFGWWFFLGPKFKKLQDEGSSSWKCKRNN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004733
ORF Size 1647 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004733.1, NM_004733.2, NM_004733.3, NP_004724
RefSeq Size 2659
Locus ID 9197
Cytogenetics 3q25.31
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways
MW 60.7 kDa
Gene Summary The protein encoded by this gene is required for the formation of O-acetylated (Ac) gangliosides. The encoded protein is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Defects in this gene have been reported to cause spastic paraplegia autosomal dominant type 42 (SPG42) in one Chinese family, but not in similar patients of European descent. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.