RNF31 (NM_017999) Human Tagged ORF Clone

CAT#: RC204117

Reviews ()
Write a review

RNF31 (Myc-DDK-tagged)-Human ring finger protein 31 (RNF31)



  "NM_017999" in other vectors (8)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 880.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RNF31
Synonyms HOIP; Paul; ZIBRA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204117 representing NM_017999
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGGAGGAAGAGGAGCGGGCCTTCCTGGTGGCCCGCGAGGAGCTGGCGAGCGCCCTGAGGAGGG
ATTCCGGGCAGGCGTTTTCCCTGGAGCAGCTCCGGCCGCTACTAGCCAGCTCTCTGCCGCTAGCCGCCCG
CTACCTGCAGCTGGACGCCGCACGCCTTGTCCGCTGCAACGCTCATGGGGAGCCCCGAAACTACCTCAAC
ACCCTGTCCACGGCTCTGAACATCCTGGAGAAATACGGCCGCAACCTTCTCAGCCCTCAGCGGCCTCGGT
ACTGGCGTGGTGTCAAGTTTAATAACCCTGTCTTTCGCAGCACGGTGGATGCTGTGCAGGGGGGCCGAGA
TGTGCTGCGATTATATGGCTACACAGAGGAGCAACCAGATGGGTTGAGCTTCCCCGAAGGGCAGGAGGAG
CCAGATGAGCACCAGGTTGCTACAGTCACACTGGAAGTACTGCTGCTTCGGACAGAGCTCAGCCTGCTAT
TGCAGAATACTCATCCAAGACAGCAGGCACTGGAGCAGCTGTTGGAAGACAAGGTTGAAGATGATATGCT
GCAGCTTTCAGAATTTGACCCCCTATTGAGAGAGATTGCTCCTGGCCCCCTCACCACACCCTCTGTCCCA
GGCTCCACTCCTGGTCCCTGCTTCCTCTGTGGTTCTGCCCCAGGCACACTGCACTGCCCATCCTGTAAAC
AGGCCCTGTGTCCAGCCTGTGACCACCTGTTCCATGGACACCCATCCCGTGCTCATCACCTCCGCCAGAC
CCTGCCTGGGGTCCTGCAGGGTACCCACCTGAGCCCCAGTTTACCTGCCTCAGCCCAACCACGGCCCCAG
TCGACCTCCCTGCTGGCCCTGGGAGACAGCTCTCTTTCTTCCCCTAATCCTGCAAGTGCTCATTTGCCCT
GGCACTGTGCTGCCTGTGCCATGCTAAATGAGCCTTGGGCAGTGCTCTGTGTGGCCTGTGATCGGCCCCG
AGGCTGTAAGGGGTTGGGGTTGGGAACTGAGGGTCCCCAAGGAACTGGAGGCCTAGAACCTGATCTTGCA
CGGGGTCGGTGGGCCTGCCAGAGCTGTACCTTTGAGAATGAGGCAGCTGCTGTGCTATGTTCCATATGTG
AGCGACCTCGGCTGGCCCAGCCTCCCAGCTTGGTGGTGGATTCCCGAGATGCTGGCATTTGCCTGCAACC
CCTTCAGCAGGGGGATGCTTTGCTGGCCTCTGCCCAGAGTCAAGTCTGGTACTGTATTCACTGTACCTTC
TGCAACTCGAGCCCTGGCTGGGTGTGTGTTATGTGCAACCGGACTAGTAGCCCCATTCCAGCACAACATG
CCCCCCGGCCCTATGCCAGCTCTTTGGAAAAGGGACCCCCCAAGCCTGGGCCCCCACGACGCCTTAGTGC
CCCCCTGCCCAGTTCCTGTGGAGATCCTGAGAAGCAGCGCCAAGACAAGATGCGGGAAGAAGGCCTCCAG
CTAGTGAGCATGATCCGGGAAGGGGAAGCCGCAGGTGCCTGTCCAGAGGAGATCTTCTCGGCTCTGCAGT
ACTCGGGCACTGAGGTGCCTCTGCAGTGGTTGCGCTCAGAACTGCCCTACGTCCTGGAGATGGTGGCTGA
GCTGGCTGGACAGCAGGACCCTGGGCTGGGTGCCTTTTCCTGTCAGGAGGCCCGGAGAGCCTGGCTGGAT
CGTCATGGCAACCTTGATGAAGCTGTGGAGGAGTGTGTGAGGACCAGGCGAAGGAAGGTGCAGGAGCTCC
AGTCTCTAGGCTTTGGGCCTGAGGAGGGGTCTCTCCAGGCATTGTTCCAGCACGGAGGTGATGTGTCACG
GGCCCTGACTGAGCTACAGCGCCAACGCCTAGAGCCCTTCCGCCAGCGCCTCTGGGACAGTGGCCCTGAG
CCCACCCCTTCCTGGGATGGGCCAGACAAGCAGAGCCTGGTCAGGCGGCTTTTGGCAGTCTACGCACTCC
CCAGCTGGGGCCGGGCAGAGCTGGCACTGTCACTGCTGCAGGAGACACCCAGGAACTATGAGTTGGGGGA
TGTGGTAGAAGCTGTGAGGCACAGCCAGGACCGGGCCTTCCTGCGCCGCTTGCTTGCCCAGGAGTGTGCC
GTGTGTGGCTGGGCCCTGCCCCACAACCGGATGCAGGCCCTGACTTCCTGTGAGTGCACCATCTGTCCTG
ACTGCTTCCGCCAGCACTTCACCATCGCCTTGAAGGAGAAGCACATCACAGACATGGTGTGCCCTGCCTG
TGGCCGCCCCGACCTCACCGATGACACACAGTTGCTCAGCTACTTCTCTACCCTTGACATCCAGCTTCGC
GAGAGCCTAGAGCCAGATGCCTATGCGTTGTTCCATAAGAAGCTGACCGAGGGTGTGCTGATGCGGGACC
CCAAGTTCTTGTGGTGTGCCCAGTGCTCCTTTGGCTTCATATATGAGCGTGAGCAGCTGGAGGCAACTTG
TCCCCAGTGTCACCAGACCTTCTGTGTGCGCTGCAAGCGCCAGTGGGAGGAGCAGCACCGAGGTCGGAGC
TGTGAGGACTTCCAGAACTGGAAACGCATGAACGACCCAGAATACCAGGCCCAGGGCCTAGCAATGTATC
TTCAGGAAAACGGCATTGACTGCCCCAAATGCAAGTTCTCGTACGCCCTGGCCCGAGGAGGCTGCATGCA
CTTTCACTGTACCCAGTGCCGCCACCAGTTCTGCAGCGGCTGCTACAATGCCTTTTACGCCAAGAATAAA
TGTCCAGAGCCTAACTGCAGGGTGAAAAAGTCCCTGCACGGCCACCACCCTCGAGACTGCCTCTTCTACC
TGCGGGACTGGACTGCTCTCCGGCTTCAGAAGCTGCTACAGGACAATAACGTCATGTTTAATACAGAGCC
TCCAGCTGGGGCCCGGGCAGTCCCTGGAGGCGGCTGCCGAGTGATAGAGCAGAAGGAGGTTCCCAATGGG
CTCAGGGACGAAGCTTGTGGCAAGGAAACTCCAGCTGGCTATGCCGGCCTGTGCCAGGCACACTACAAAG
AGTATCTTGTGAGCCTCATCAATGCCCACTCGCTGGACCCAGCCACCTTGTATGAGGTGGAAGAGCTGGA
GACGGCCACTGAGCGCTACCTGCACGTACGCCCCCAGCCTTTGGCTGGAGAGGATCCCCCTGCTTACCAG
GCCCGCTTGTTACAGAAGCTGACAGAAGAGGTACCCTTGGGACAGAGTATCCCCCGCAGGCGGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204117 representing NM_017999
Red=Cloning site Green=Tags(s)

MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLN
TLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEE
PDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLEDKVEDDMLQLSEFDPLLREIAPGPLTTPSVP
GSTPGPCFLCGSAPGTLHCPSCKQALCPACDHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQ
STSLLALGDSSLSSPNPASAHLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLA
RGRWACQSCTFENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQRQDKMREEGLQ
LVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAGQQDPGLGAFSCQEARRAWLD
RHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQHGGDVSRALTELQRQRLEPFRQRLWDSGPE
PTPSWDGPDKQSLVRRLLAVYALPSWGRAELALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECA
VCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLR
ESLEPDAYALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNK
CPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNG
LRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQ
ARLLQKLTEEVPLGQSIPRRRK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_017999
ORF Size 3216 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_017999.5
RefSeq Size 3571 bp
RefSeq ORF 3219 bp
Locus ID 55072
UniProt ID Q96EP0
Cytogenetics 14q12
Domains IBR
Protein Families Druggable Genome
MW 119.5 kDa
Gene Summary The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. The encoded protein is the E3 ubiquitin-protein ligase component of the linear ubiquitin chain assembly complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]

Other Versions

Other products for "RNF31"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal Anti-RNF31 Antibody
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.