HIPPI (IFT57) (NM_018010) Human Tagged ORF Clone

CAT#: RC204116

Reviews ()
Write a review

IFT57 (Myc-DDK-tagged)-Human intraflagellar transport 57 homolog (Chlamydomonas) (IFT57)



  "NM_018010" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IFT57
Synonyms ESRRBL1; HIPPI; MHS4R2; OFD18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204116 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGCTGCTCTGGCCGTCGTCACGACGTCGGGTTTGGAAGATGGGGTGCCTAGGTCCCGTGGCGAAG
GGACCGGGGAAGTGGTCTTGGAGCGGGGGCCCGGCGCGGCCTACCACATGTTCGTGGTGATGGAGGACTT
GGTGGAGAAGCTGAAGCTGCTCCGCTACGAGGAGGAGTTCCTCCGGAAGAGCAACCTGAAGGCCCCGTCC
AGACACTATTTTGCACTGCCTACCAACCCTGGCGAACAGTTCTACATGTTTTGTACTCTTGCTGCTTGGT
TGATTAATAAAGCGGGACGTCCCTTTGAGCAGCCTCAAGAATATGATGACCCTAATGCAACAATATCTAA
CATACTATCCGAGCTTCGGTCATTTGGAAGAACTGCAGATTTTCCTCCTTCAAAATTAAAGTCAGGTTAT
GGAGAACATGTATGCTATGTTCTTGATTGCTTCGCTGAAGAAGCATTGAAATATATTGGTTTCACCTGGA
AAAGGCCAATATACCCAGTAGAAGAATTAGAAGAAGAAAGCGTTGCAGAAGATGATGCAGAATTAACATT
AAATAAAGTGGATGAAGAATTTGTGGAAGAAGAGACAGATAATGAAGAAAACTTTATTGATCTCAACGTT
TTAAAGGCCCAGACATATCACTTGGATATGAACGAGACTGCCAAACAAGAAGATATTTTGGAATCCACAA
CAGATGCTGCAGAATGGAGCCTAGAAGTGGAACGTGTACTACCGCAACTGAAAGTCACGATTAGGACTGA
CAATAAGGATTGGAGAATCCATGTTGACCAAATGCACCAGCACAGAAGTGGAATTGAATCTGCTCTAAAG
GAGACCAAGGGATTTTTGGACAAACTCCATAATGAAATTACTAGGACTTTGGAAAAGATCAGCAGCCGAG
AAAAGTACATCAACAATCAGCTTGAGAATTTGGTTCAAGAATATCGTGCAGCTCAAGCCCAGCTGAGTGA
GGCAAAGGAGCGATACCAGCAGGGAAATGGAGGAGTGACGGAAAGAACCAGACTCCTCTCTGAGGTTATG
GAAGAATTAGAAAAGGTAAAACAAGAAATGGAAGAAAAGGGCAGCAGCATGACTGATGGTGCTCCTTTGG
TGAAGATTAAACAGAGCTTAACAAAACTGAAGCAAGAAACTGTAGAGATGGACATTAGAATTGGCATTGT
GGAACACACACTACTCCAATCAAAGCTGAAGGAGAAGTCCAACATGACTAGGAACATGCATGCCACAGTT
ATTCCAGAACCAGCAACAGGCTTTTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204116 protein sequence
Red=Cloning site Green=Tags(s)

MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPS
RHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGY
GEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLNV
LKAQTYHLDMNETAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALK
ETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVM
EELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATV
IPEPATGFY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018010
ORF Size 1287 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018010.4
RefSeq Size 3223 bp
RefSeq ORF 1290 bp
Locus ID 55081
UniProt ID Q9NWB7
Cytogenetics 3q13.12-q13.13
Protein Families Druggable Genome
Protein Pathways Huntington's disease
MW 49.1 kDa
Gene Summary Required for the formation of cilia. Plays an indirect role in sonic hedgehog signaling, cilia being required for all activity of the hedgehog pathway (By similarity). Has pro-apoptotic function via its interaction with HIP1, leading to recruit caspase-8 (CASP8) and trigger apoptosis. Has the ability to bind DNA sequence motif 5'-AAAGACATG-3' present in the promoter of caspase genes such as CASP1, CASP8 and CASP10, suggesting that it may act as a transcription regulator; however the relevance of such function remains unclear.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "IFT57"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Anti-IFT57 (HIPPI) mouse monoclonal antibody, clone OTI4F6 (formerly 4F6)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.