CYP1B1 (NM_000104) Human Tagged ORF Clone

CAT#: RC204074

CYP1B1 (Myc-DDK-tagged)-Human cytochrome P450, family 1, subfamily B, polypeptide 1 (CYP1B1)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 4 publications.

Product images

Specifications

Product Data
Product Name CYP1B1 (NM_000104) Human Tagged ORF Clone
Symbol CYP1B1
Synonyms CP1B; CYPIB1; GLC3A; P4501B1
Vector pCMV6-Entry
Sequence Data
>RC204074 representing NM_000104
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACCAGCCTCAGCCCGAACGACCCTTGGCCGCTAAACCCGCTGTCCATCCAGCAGACCACGCTCC
TGCTACTCCTGTCGGTGCTGGCCACTGTGCATGTGGGCCAGCGGCTGCTGAGGCAACGGAGGCGGCAGCT
CCGGTCCGCGCCCCCGGGCCCGTTTGCGTGGCCACTGATCGGAAACGCGGCGGCGGTGGGCCAGGCGGCT
CACCTCTCGTTCGCTCGCCTGGCGCGGCGCTACGGCGACGTTTTCCAGATCCGCCTGGGCAGCTGCCCCA
TAGTGGTGCTGAATGGCGAGCGCGCCATCCACCAGGCCCTGGTGCAGCAGGGCTCGGCCTTCGCCGACCG
GCCGGCCTTCGCCTCCTTCCGTGTGGTGTCCGGCGGCCGCAGCATGGCTTTCGGCCACTACTCGGAGCAC
TGGAAGGTGCAGCGGCGCGCAGCCCACAGCATGATGCGCAACTTCTTCACGCGCCAGCCGCGCAGCCGCC
AAGTCCTCGAGGGCCACGTGCTGAGCGAGGCGCGCGAGCTGGTGGCGCTGCTGGTGCGCGGCAGCGCGGA
CGGCGCCTTCCTCGACCCGAGGCCGCTGACCGTCGTGGCCGTGGCCAACGTCATGAGTGCCGTGTGTTTC
GGCTGCCGCTACAGCCACGACGACCCCGAGTTCCGTGAGCTGCTCAGCCACAACGAAGAGTTCGGGCGCA
CGGTGGGCGCGGGCAGCCTGGTGGACGTGATGCCCTGGCTGCAGTACTTCCCCAACCCGGTGCGCACCGT
TTTCCGCGAATTCGAGCAGCTCAACCGCAACTTCAGCAACTTCATCCTGGACAAGTTCTTGAGGCACTGC
GAAAGCCTTCGGCCCGGGGCCGCCCCCCGCGACATGATGGACGCCTTTATCCTCTCTGCGGAAAAGAAGG
CGGCCGGGGACTCGCACGGTGGTGGCGCGCGGCTGGATTTGGAGAACGTACCGGCCACTATCACTGACAT
CTTCGGCGCCAGCCAGGACACCCTGTCCACCGCGCTGCAGTGGCTGCTCCTCCTCTTCACCAGGTATCCT
GATGTGCAGACTCGAGTGCAGGCAGAATTGGATCAGGTCGTGGGGAGGGACCGTCTGCCTTGTATGGGTG
ACCAGCCCAACCTGCCCTATGTCCTGGCCTTCCTTTATGAAGCCATGCGCTTCTCCAGCTTTGTGCCTGT
CACTATTCCTCATGCCACCACTGCCAACACCTCTGTCTTGGGCTACCACATTCCCAAGGACACTGTGGTT
TTTGTCAACCAGTGGTCTGTGAATCATGACCCAGTGAAGTGGCCTAACCCGGAGAACTTTGATCCAGCTC
GATTCTTGGACAAGGATGGCCTCATCAACAAGGACCTGACCAGCAGAGTGATGATTTTTTCAGTGGGCAA
AAGGCGGTGCATTGGCGAAGAACTTTCTAAGATGCAGCTTTTTCTCTTCATCTCCATCCTGGCTCACCAG
TGCGATTTCAGGGCCAACCCAAATGAGCCTGCGAAAATGAATTTCAGTTATGGTCTAACCATTAAACCCA
AGTCATTTAAAGTCAATGTCACTCTCAGAGAGTCCATGGAGCTCCTTGATAGTGCTGTCCAAAATTTACA
AGCCAAGGAAACTTGCCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204074 representing NM_000104
Red=Cloning site Green=Tags(s)

MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLIGNAAAVGQAA
HLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAFASFRVVSGGRSMAFGHYSEH
WKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVALLVRGSADGAFLDPRPLTVVAVANVMSAVCF
GCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHC
ESLRPGAAPRDMMDAFILSAEKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYP
DVQTRVQAELDQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPVKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQ
CDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETCQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000104
ORF Size 1629 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000104.1, NM_000104.2, NM_000104.3, NP_000095
RefSeq Size 5128
RefSeq ORF 1632
Locus ID 1545
Cytogenetics 2p22.2
Domains p450
Protein Families P450, Druggable Genome
Protein Pathways Tryptophan metabolism, Metabolism of xenobiotics by cytochrome P450
MW 60.7 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (4)